KEGG   Desulfococcus multivorans: Dmul_07730Help
Entry
Dmul_07730        CDS       T04568                                 

Gene name
ppc
Definition
(GenBank) Ppc: phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dml  Desulfococcus multivorans
Pathway
dml00620  Pyruvate metabolism
dml00680  Methane metabolism
dml01100  Metabolic pathways
dml01120  Microbial metabolism in diverse environments
dml01200  Carbon metabolism
Module
dml_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmul_07730 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Dmul_07730 (ppc)
Enzymes [BR:dml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dmul_07730 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOY57548
LinkDB All DBs
Position
complement(853280..856039)
Genome map
AA seq 919 aa AA seqDB search
MRELSGFDIDAGGGVSAPLRYHVNLLGRILGNVIREQAGEGIFSLVEDLRHHAKAAEASR
DPVLFEEIYHRIHSLDLDDIFWLIRAYTAFFHLTNEAERREIARINAEAERSQTDQTPRS
ESILEAVFKLKTSRQSYESVRTLVDRVEIEPTLTAHPTEARRGSILFKQNEIARLLAKVS
PDIGLSAAEIGKRIGRIHREITLLMVTDDIRADRLRVEDEIENGLYYCTTSIWETIPRIF
ADMQEAFETYYGKAPDLPPFLCYRTWIGGDRDGNPLVTPEVTREALAVYRKAVLEKYREE
LQALWQQMSVSALRAPFPPAVAENIAGETDTVRLDPQFLHRYRHEPLRVKLSCMIEKIDR
LLADPSEAGYTAQDFETDLCLIRDALASAGLGAVAREGRLNDLIIRARVFGFHFIALDIR
QHSQVHEQALAELLRQAGTVVDYASLPEDEKIQLLATELENPRPLVGCRTELSSATADVI
TVMTLIRDAAPGAVQSYVISMTHGVSDMLEVLLLAKEAGLWGIRDGAVDSRLDIVPLFET
IQDLERSGELMAEIFQNPIYQRHLAARGNFQEIMLGYSDSNKDGGYWTANWSLEKSLSTL
ADICRDHDVDFRFFHGRGGSVGRGGGRANQAILAMPAQSQNGRIRFTEQGEVISFRYAQA
PIARRHLEQIVSAVLQAASPDHCGIECSPPMRETMEAISQKAMAAYRDLIDDPAFWNWYQ
TVTPMEHIGRLPIASRPISRKSARKVQFDDLRAIPWVFAWTQTRYNVPGWYGIGTALSTV
MEARPDALGMLREMWRGWPFFRNLINNVQLEMARTHLTVAAFYDRQSSLSFHNRIAAEFE
RAEKAILAVTEQAALMENQQVIQKSIRLRTPYTHVLNLVQIELLRRWRDAGADDDALGAL
RHALFLSINGIAAAMQSTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaattgagcggtttcgatatcgatgcggggggcggcgtatccgcgcccctcagg
taccacgtcaatctcctgggacgtatcctgggcaatgtcatacgagaacaggccggagaa
ggcatcttctccctggtggaggatctgagacaccatgccaaggcggctgaggcctcccgg
gacccggtcctcttcgaagagatatatcaccgaatccattccctcgatctggacgacatc
ttttggctcatccgcgcctatacggcttttttccatctgaccaacgaggccgagcgccgt
gagattgcacgcatcaacgctgaggccgagcgcagccagaccgaccaaacaccccggagc
gaatcgatactggaggccgtgttcaagctcaagacgtcgaggcagtcgtacgaatcggtc
aggactctcgtcgatcgcgtggagatcgaacccacgctcaccgcccaccccacggaagcg
cgacgcggcagtattctgttcaagcagaacgagatcgcccggctcctcgcgaaggtctcg
ccggacatcggcctgtccgctgcggagatcggaaaacgaatcggcagaatccaccgggag
atcacgcttctcatggtcaccgacgatatccgggccgatcgtcttcgggtcgaagacgag
atcgaaaacggactctactactgcaccacgtcgatttgggagaccatccccaggattttc
gccgacatgcaagaggcttttgaaacctattacggcaaagcgcccgatcttccaccgttt
ctctgctaccgcacctggatcgggggcgaccgggacggcaaccccctggtgacgccggag
gtgacccgagaggccctggccgtttatcggaaggccgttctcgagaaataccgggaggag
cttcaagccctctggcaacagatgagcgtttcggccctccgagcgccgtttcccccggcc
gtggctgaaaatatcgccggagagaccgacaccgtccgactcgaccctcagtttctccac
cgctatcggcacgaacccctgcgggtcaagctgagctgtatgatcgaaaagatcgaccgg
ctcctggccgacccatcggaggcaggctataccgcacaagacttcgaaaccgacctctgc
ctcatccgggatgcgcttgcaagcgccgggctcggggctgtcgcgcgggaaggccgtctg
aacgatctcatcatccgcgccagggtgttcgggttccatttcatcgccctggatatccgg
cagcacagccaggtccatgaacaggcccttgcggagcttttgcggcaggcaggcaccgta
gtggattacgcgagtctccccgaggacgaaaagatccagctcctggcgacggagctggaa
aatccccgccctctggtcggctgcaggaccgaactgtcttcggcaaccgcggacgtgatc
accgtcatgaccctcatccgggatgcggctccgggggccgtccaaagctatgtcatcagc
atgacccatggcgtaagcgacatgctcgaggtactcctcctggccaaggaggccggccta
tggggtatcagggacggcgccgtcgacagccggctggacatcgtccctctctttgagacc
atccaggatctggaacgttcgggcgaactcatggccgaaatcttccagaaccccatctac
cagcggcacctggcggcccgggggaattttcaggagatcatgctcggatattccgacagc
aacaaggacggcggctactggacggccaactggtccctggagaaaagcctcagcaccctg
gccgacatctgccgggatcacgatgtcgacttccgcttcttccacgggcggggcggcagc
gtgggacggggcggaggacgggccaatcaggccatcctcgccatgccggcccagagccag
aacggccggatccgattcacggaacagggggaggtcatctccttccggtatgcccaggcc
cccatcgcccgaagacacctggaacaaatcgtcagcgccgttctccaggccgcgagtccc
gatcactgcggcatcgaatgcagcccccccatgcgggagacgatggaggcgatctcacaa
aaggccatggccgcctacagggatcttatcgacgatccggcgttctggaactggtatcag
accgtaacgcccatggagcatatcggccgcctgcccatcgcctcacggcccatctcgaga
aaatcggcccgaaaggtccaatttgacgatctgcgagccattccatgggtctttgcctgg
acccagacccgatacaacgttccgggatggtacggcatcgggacagccctctcgacggtc
atggaagcgcgtcccgacgccctcggcatgctccgggagatgtggcgcggctggcccttc
tttcggaacctgatcaacaacgtccaactggagatggcgcggactcatctgaccgtggcc
gccttctatgaccggcagtcatcgctttctttccataaccgcatcgccgcggaattcgaa
cgggcggaaaaagcgattctcgccgtaacggagcaggcggccctcatggaaaaccagcag
gtgatccagaagtctatccgactgcggaccccctacacccacgtcctgaatctggtccag
atcgaacttctcaggcgatggcgcgacgccggggcggacgatgacgccctcggggctctc
cgccacgccctcttcctcagcatcaacggcatcgcggcggccatgcagagcacggggtag

DBGET integrated database retrieval system