KEGG   Desulfococcus multivorans: Dmul_08910Help
Entry
Dmul_08910        CDS       T04568                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
dml  Desulfococcus multivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOY57666
LinkDB All DBs
Position
997799..999403
Genome map
AA seq 534 aa AA seqDB search
MIITEILSRNARRYGDQPALIEREPATGSRREITWREFDEQAGALANALILRGIQKGDRV
VLLMTNCIEWLPAYFGILRAGAMAVPLNFRFLAKTIARCTLISEAKAMIFGEEFIDRLAE
VKSELDAAVSHYIFVGQQGKRPEYAIGYGELLQEGERTASVVPLNLCDSAALYFTSGTTG
KPKAVHLTHRSLEFSCYVENRHHNQTHDDNFLCIPPLYHTGAKMHWFGNFIVGARTVILK
GVKPQWILEAVSEEGVTVVWLLVPWAHDILIGIENGEIDLAGYRLDQWRLMHIGAQPVPP
SLIRQWKKVFPHHDYDTNYGLTEATGPGCIHLGMENIHKVGAIGVPGFDWECKIIDNDGH
PVAPGDSGELAVRGPAVMKEYYKNPEATAETLVDGWLLTGDICRMDDDGFIWLVDRKKDV
IITGGENIFPVEIEDFLMQHEKIQDVGVIGVPDERLGEIVAAVIKAKPRAILTEAEINEF
CRGLARYKRPRRIFFGDVPRNPTGKIEKPLLRKQYRDVQPAVISQMAARHGLKN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatcattacggaaattttaagtcggaacgccagacgctacggcgaccagccggccctt
atcgaaagggagcccgccacgggaagccgcagggagatcacctggcgggaattcgacgaa
caggccggcgctctggccaatgcgctgatcctgcgcggtattcaaaaaggagatcgggta
gtcctgctcatgaccaactgtatcgagtggcttcccgcctatttcggcatcctccgagcc
ggcgccatggccgttcccctcaatttcaggtttctggcaaagaccatcgccagatgcaca
ctgatctccgaagccaaggccatgattttcggagaggagttcatcgatcggttggctgaa
gtcaaatccgagttggatgccgcagtaagtcattatatctttgtggggcagcagggaaaa
cggcctgaatacgcgatcggctacggcgagctgcttcaggaaggtgaaaggacggcgtct
gttgtgccgttgaacctttgcgacagcgcagccctttatttcacgtcgggcaccaccgga
aagcccaaggccgtccacctcacccatcggagcctcgagttttcatgctacgtggagaat
cgtcatcacaaccagacccacgacgacaatttcctctgcattcctcctttataccatacc
ggggcgaagatgcactggttcgggaactttatcgtcggcgccagaacggttatcctgaaa
ggcgtcaaaccccagtggatcctcgaggcggtctccgaggaaggcgtaacggtggtatgg
ctcctggtcccctgggcccacgatatcctcatcggtatcgagaacggtgagatcgatctt
gcgggctaccgcctcgaccaatggcgactgatgcatatcggcgcccagccggtgcctcca
agcctcatccgtcagtggaagaaggtgtttccccaccatgactacgataccaattatggt
ctgaccgaggctacgggaccggggtgtatccatctcggcatggagaatattcacaaggtc
ggcgctatcggcgtgcccgggttcgactgggaatgcaagatcatcgacaacgacggtcat
cccgtggcgccgggtgattccggagagttggccgtccgggggccggccgtcatgaaggag
tactacaagaacccggaggccaccgcggaaacccttgtcgacggatggctgcttacaggg
gatatctgccggatggacgatgacggtttcatatggctcgtggatcgcaagaaagacgtc
atcatcaccggcggtgagaatatctttccggtggagatcgaggattttctcatgcagcac
gaaaagattcaggacgttggcgtgatcggcgttcccgacgagcggctgggggaaattgtc
gcggcggtgatcaaggccaagccgagagcgatccttaccgaagcggagatcaatgaattc
tgccgcggattggcccgctacaagcggcctcggcggatctttttcggagatgtgccgaga
aatcctacgggcaagatcgagaagccgcttttgagaaaacagtatcgagacgtccaacct
gccgttatttcccagatggcggctcgccacgggttgaaaaactga

DBGET integrated database retrieval system