KEGG   Desulfococcus multivorans: Dmul_09510Help
Entry
Dmul_09510        CDS       T04568                                 

Gene name
glpD
Definition
(GenBank) GlpD: glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dml  Desulfococcus multivorans
Pathway
dml00564  Glycerophospholipid metabolism
dml01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmul_09510 (glpD)
Enzymes [BR:dml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dmul_09510 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Pyr_redox_3 Thi4 TetR_C_15
Motif
Other DBs
NCBI-ProteinID: AOY57726
LinkDB All DBs
Position
1061717..1063321
Genome map
AA seq 534 aa AA seqDB search
MNRDDMLKRIRRRETEWDFIIVGGGATGLGTAIDGASRGYQVLLIEQSDFAKGTSSRSTK
LVHGGVRYLQQGNISLVLEALKERGLMRRNAPHLVHNLPFVVPNYDWWEGPFYGIGLKVY
DMLAGRHGFGHSKGLSKEKTLEFIPTLEPKGLRGGVIYYDGQFDDARLAVNMAQTAVEQG
GTVVNYMRVESLVKSGEMVRGVRARDLETGELYELTAKVVINATGVFSDGLRKMDDPEAP
DIITPSQGVHIVLDRSFLPGDTAIMVPHTDDGRVLFAIPWKHRVVVGTTDTEMTEATLDP
CPLPEEIDFLLAHAARYLTQDPTREDILSTFAGLRPLVSLGSHENTAAISRDHTLNISRS
GLLTITGGKWTTYRKMAEETVDQAILLAQLQERPSVTRDLNIHGFHQNAVQFGHLAVYGA
DARSVREVLGEDTRYAKPLHPDHPYLAGEVVWAVRREMARTVEDFLSRRRRVLPTDARAS
IEMAPAVATLMARELGRDSRWADDQTTAFEDLARGYLADGRCRLKTKNSGEIPS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggacgacatgctgaaaagaattcggcggcgggaaacggaatgggacttcatc
attgtcggcggaggcgccactggtctgggaaccgccattgacggggcgtcccggggatat
caggtcctgctgatcgaacagagcgattttgccaagggaacctccagtcggagcaccaag
ctggtccatggaggggttcgctaccttcagcagggaaatatctctctcgttctggaggcc
ttgaaggagcggggactgatgcggcggaacgctccccatctcgtccataacctgcctttt
gtcgtgcccaactatgactggtgggaggggcctttttacggcatcggtctcaaggtttac
gacatgctggccggtcgacacggtttcggccattccaaaggtctttccaaggagaaaacc
cttgaattcatccccacactggaacccaagggcttgcggggaggcgttatctactatgac
ggccagttcgacgatgcccgactggccgtcaacatggcccagaccgcggtggaacagggt
ggtacggtggtcaactatatgcgggtggagtcccttgtcaaatcgggcgaaatggtgcga
ggggtacgtgcccgggatctggagaccggggaactttacgaactgacggcaaaggtcgtc
atcaacgccaccggcgtcttctccgacggtctgagaaaaatggacgatcctgaggcccct
gacatcatcacccccagtcagggcgtccatatcgttctggacagatcgtttctgccgggg
gatacggccatcatggtgccccacaccgacgatggtcgcgtccttttcgccattccatgg
aagcaccgcgtcgtggtgggcactacggataccgagatgaccgaggcgaccctggatccc
tgccccttgccggaggagatcgattttctgttagcccatgcggcgcgttatctgacccag
gacccgactcgggaggacatcctgagcacctttgccggtctccggcccctcgtgagcctg
gggagccacgagaacaccgccgccatttcccgggaccacactctcaacatatcccggtca
gggcttctcaccatcaccggcggcaaatggaccacctacagaaaaatggccgaggagacg
gtggaccaggcgatcctgctggcgcagctccaggagcggccttctgtcacgagagacctc
aacatccacggatttcatcaaaatgctgtccagttcggccatctggccgtgtatggcgcc
gacgcccggtcggtccgggaggtgctgggagaggatacccggtacgccaagccccttcac
cccgaccatccttacctggccggagaggtcgtctgggcggtccgtcgtgaaatggcgcga
acggtggaggatttcctctcgcgccgccgccgggtgcttcccaccgacgcccgggcgagc
atcgagatggcgcccgcggtcgcaaccttgatggctcgggagctggggcgtgacagccgc
tgggccgacgatcagacgacggccttcgaagacctggcccgggggtatttggctgacggc
cgatgccgcctgaaaacgaaaaacagcggagaaatcccctcctga

DBGET integrated database retrieval system