KEGG   Desulfococcus multivorans: Dmul_12270Help
Entry
Dmul_12270        CDS       T04568                                 

Gene name
sodB
Definition
(GenBank) sodB: superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dml  Desulfococcus multivorans
Brite
Enzymes [BR:dml01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dmul_12270 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOY58002
LinkDB All DBs
Position
1372625..1373368
Genome map
AA seq 247 aa AA seqDB search
MNVVRVAIHHYPHSREEIMKRREFIKVSVGLGAIATLQMAGISCSEKRAGGSVSLPPLPY
KADALAPGISARTMSFHYGKHHRGYVDKLNTLIRETSLANLPIEEIIRKTHGKTDQIAVF
NNAAQVYNHTFYWNSMIPGGGGKPRGILADRIDAAFGGYDQFVQEFTNVAASQFGSGWAW
LVQDEASLKIVGTSNADTPITAGMKPLLVIDVWEHAYYLDYQNRRKEYITAYLNDLVNWS
FAEKNLV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgtccgtgtcgcgattcatcactacccccattcaagagaggagattatgaaa
agaagagaatttataaaagtttcagtaggtttaggggcgatcgcaacacttcagatggcc
ggcatcagctgcagtgaaaagcgtgccggcggatcggtgtccctgcctccgttgccttac
aaggcggatgcgttggcgcccggtatttccgcaaggacgatgtctttccattacggcaag
caccatcgcggctatgttgacaaactcaatacacttatccgcgaaacgtcgcttgcgaac
ctcccgatcgaggagatcatccggaaaacccacggaaagacggaccagatcgcggtgttt
aacaatgcggcccaggtttacaaccataccttttattggaacagcatgattcccggtggg
ggcggaaaacccaggggaatccttgccgacaggatcgacgcggctttcggtggttatgat
cagttcgttcaagaatttacgaacgtggcggcctcacagttcggaagcggctgggcgtgg
ctggtccaggacgaagcgtcattgaagatcgtggggacatccaacgccgatacgcccatt
acggcagggatgaagccgcttttggtcattgacgtatgggagcatgcctattatctggat
tatcagaatcgccggaaggagtatatcacggcttacctgaacgacctggtcaactggagc
ttcgctgaaaaaaatctcgtataa

DBGET integrated database retrieval system