KEGG   Desulfococcus multivorans: Dmul_17240Help
Entry
Dmul_17240        CDS       T04568                                 

Gene name
lcfA2
Definition
(GenBank) LcfA2: long-chain-fatty-acid--CoA ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
dml  Desulfococcus multivorans
Brite
KEGG Orthology (KO) [BR:dml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dml01004]
    Dmul_17240 (lcfA2)
Enzymes [BR:dml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Dmul_17240 (lcfA2)
Lipid biosynthesis proteins [BR:dml01004]
 Acyl-CoA synthetase
  Unknown
   Dmul_17240 (lcfA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOY58497
LinkDB All DBs
Position
complement(1937602..1939251)
Genome map
AA seq 549 aa AA seqDB search
MRTDKLMDVTLGQLLDQAVSTHPDNDAVIYVDRAFRLSYREFGDLVDRLARGLMALGIQK
GEKVAVWATNVPYWVALQFATAKIGAVLLTVNTNYKSSELTYLLKQSETENLFIIDGFRD
TDYVQTVYELVPELKLQERGFLTSPKFPSLKRVCFLGQEKHRGMYTIPEILALAVMTTDA
AYQERRRTLNPHDVVNMQYTSGTTGFPKGVMLTHHNIVNNGFWVGENQRFTPADRICIPV
PLFHCFGCVMGVLGAVSHAATMVFLESFDPVDVMASVEEERCTALYGVPTMFMAVLHHKL
FDKFDFSTLRTGIMAGSPCPIEIMKQVIDRLNMHEITICYGLTETSPVITQTRAEDDIRL
RVESVGRALPGIEVRIVDPETHAPLPVGTQGEVCCRGYNVMKGYYNMSEATAQAVDTDGW
LHSGDLGVMDENGYLSITGRHKDMIIRGGENIYPREIEEFLFQMEGIADVQVAGVPSPKY
GEEIGAFIKIKEGHVMAPEDVRDFCRGRISHYKIPRYVAFVDDYPMTASGKIQKYKLRDL
SVTLFPDRR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacggacaaactgatggacgtgaccctgggacagcttctggatcaggcggtttca
acacatccggacaacgacgccgtcatttatgtcgaccgggcattccgtctcagttacagg
gaattcggggatctggtggatcgcctggcccgaggcctgatggctctgggcattcaaaag
ggcgaaaaggtggccgtctgggccaccaatgtcccttactgggttgcacttcagttcgcg
acagccaaaatcggtgccgtcctgctcacggtcaacacgaattacaaatcgagcgagctg
acttatctgttgaaacaatccgagacggaaaaccttttcatcatcgatggatttcgagat
acggattacgtacaaaccgtttacgagttggttcccgaattgaaacttcaggagcggggc
tttctcacaagcccgaaattcccctccctgaagcgcgtctgcttcctggggcaggaaaag
cacagagggatgtataccatcccggaaatcctggcgctcgccgtcatgaccaccgacgca
gcctaccaggagcgccggcgaacgctgaatccgcatgacgtcgtcaacatgcagtacacc
tcgggaaccacagggttccccaaaggcgtcatgctgacccatcacaatattgtcaacaac
ggcttctgggtcggcgaaaaccagcgattcacaccggccgaccgaatctgcatccccgtg
ccgctgtttcattgttttggctgcgttatgggcgtattgggggcagtatctcatgctgca
accatggtttttctggaaagcttcgatccggtggacgtcatggcgtcggtggaagaggaa
cgttgcacggccctctatggggtgcccaccatgttcatggcggtcctgcaccacaaactg
ttcgacaaattcgatttcagcaccctccggaccggcatcatggcgggatcaccctgcccc
atcgagatcatgaaacaggtaatcgatcgcctgaatatgcacgagatcaccatctgctac
ggccttacggaaacctcgccggtgatcacccaaacccgcgccgaggatgatatccgcctt
cgcgtggagtccgtcggtcgggccttgccgggcatcgaagtccgtatcgtggaccctgaa
acccacgcccccctccccgtcggtacgcagggagaggtctgttgccggggatacaacgtc
atgaaaggatactacaatatgtccgaggccacggctcaggccgtcgacactgacggctgg
ctccactcaggcgatctcggcgtcatggatgagaacggctatctgagtatcacgggacgg
cataaagatatgatcatccgggggggagaaaatatctatcccagggagatcgaagaattt
ctctttcagatggaagggatagcggacgttcaggtggccggcgttcccagtcctaagtac
ggcgaggagatcggcgccttcatcaaaatcaaggagggccatgtcatggcgccggaggat
gtgcgggatttctgcagaggcaggatcagccattataaaattccccgctacgtcgccttt
gtcgacgattatccgatgacggccagcggaaagatccagaaatacaaactgcgcgacttg
tccgtcacgttgtttccggatcgacgctga

DBGET integrated database retrieval system