KEGG   Desulfococcus multivorans: Dmul_24630Help
Entry
Dmul_24630        CDS       T04568                                 

Gene name
fadD3
Definition
(GenBank) FadD3: long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dml  Desulfococcus multivorans
Pathway
dml00061  Fatty acid biosynthesis
dml00071  Fatty acid degradation
dml01100  Metabolic pathways
dml01212  Fatty acid metabolism
dml02024  Quorum sensing
Module
dml_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dmul_24630 (fadD3)
   00071 Fatty acid degradation
    Dmul_24630 (fadD3)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dmul_24630 (fadD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dml01004]
    Dmul_24630 (fadD3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dml04147]
    Dmul_24630 (fadD3)
Enzymes [BR:dml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Dmul_24630 (fadD3)
Lipid biosynthesis proteins [BR:dml01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Dmul_24630 (fadD3)
Exosome [BR:dml04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Dmul_24630 (fadD3)
  Exosomal proteins of breast cancer cells
   Dmul_24630 (fadD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOY59235
LinkDB All DBs
Position
2763296..2764795
Genome map
AA seq 499 aa AA seqDB search
MNIVSNLERSVTFCPDKPAIIFEDTPITYKELHLKVCRLASRMRSLGVKKGDRIALFMAN
IPEFAIVYYAAMKLGAIAVSLNVMLVKNEVKYILGDCGAKIIFVGEDQACQVPTDDPDAL
EHIILVEGDENNEHHISRVYDTGVETFQALDMADTDPAVILYTSGTTGYPKGATLSHFNV
VANVNSTNYHIRSTKEDVFHLFLPLFHCFGQNFIMNSCIKKGATLVMHKRFEPAPVIEAV
KKHKVTMFFAVPTIYIYLLNMKDEEIDFSSIRYFFTAASVMPNDVANRWRAKYGIPINDG
YGLTECSPFACYNHDFNYKPGAIGHPVINVQMKIVGEDGKAAAPGEWGEICIKGPNVMLG
YWNKPTETEKTIIDGWLHTGDVGAQDEDGDFFIVDRVKDMIISAGNNIYPAEVENHIYAH
PAVNEVAVLGIPNDVKGESVKAVIVLKPGEKVDPEEMIEFCKERMSRYKVPKYIDFVTEL
PKSATGKILKRILRDEAAD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgtcagtaatcttgaaagaagtgtaacattctgtcctgacaagcccgccatt
atttttgaagatacccccataacctataaagagcttcatcttaaagtctgccgccttgca
tcaagaatgcgcagtctcggcgttaaaaagggagatcgtattgcccttttcatggccaat
attcccgagtttgcgatcgtttactatgccgctatgaagcttggtgccattgctgtatcc
ctcaatgtcatgctggtaaaaaatgaagtcaagtatatcctgggagactgcggcgccaaa
atcatattcgtcggagaagaccaggcctgccaggtacccacggacgatccggatgcattg
gaacatataattctagtagaaggtgatgaaaacaatgagcatcacatcagccgcgtatac
gataccggtgttgaaacctttcaggcccttgacatggccgacacggatccggcagtcatc
ctttacacctccggcaccacaggataccccaaaggggcgacgttgagtcattttaatgtt
gtcgccaacgtcaactctaccaattaccatatccgctccacaaaagaggacgtttttcac
ctgtttttgcctctgtttcattgtttcgggcaaaatttcatcatgaactcgtgcatcaaa
aaaggggcgacccttgtcatgcacaaacgttttgagccggcccctgtgatcgaagccgtc
aaaaaacacaaagtcaccatgttcttcgctgttcccaccatttatatctaccttttaaat
atgaaagatgaggagattgatttttccagcatccggtattttttcacagcggcctctgtc
atgccgaatgatgtggccaacaggtggcgcgccaagtacggcatacccatcaatgacggg
tacggtctgacggaatgttctccttttgcatgctataatcatgattttaactacaagcca
ggcgccatcggccatccggtcattaacgtgcagatgaaaatcgtcggtgaagacggcaaa
gcggcggctccgggcgaatggggtgaaatctgcatcaaggggcccaatgtcatgctgggc
tactggaacaaacccacagagaccgaaaagaccattattgacggctggctgcacactggt
gatgttggggcccaggatgaagacggcgactttttcattgttgaccgggtaaaagatatg
atcatttcagccggcaacaacatttatcccgctgaagtcgaaaatcatatctacgcgcat
ccggcggttaacgaagtggctgtgctcggaatcccgaatgatgtcaaaggagagtctgtc
aaggcagtcatcgtgctcaaacctggagaaaaagttgatcctgaggaaatgatcgagttc
tgcaaggaacggatgtccagatacaaggtgccaaaatacatcgattttgtcacagaactt
cctaaaagcgccaccggcaagatcctcaaacgaatcctgcgtgatgaggccgccgattaa

DBGET integrated database retrieval system