KEGG   Desulfococcus multivorans: Dmul_24830Help
Entry
Dmul_24830        CDS       T04568                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
dml  Desulfococcus multivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOY59255
LinkDB All DBs
Position
complement(2787704..2789284)
Genome map
AA seq 526 aa AA seqDB search
MNFSKYAAINARHHSNKICLIERTPSIEKRRTLTWKQFNDAINRVANYLAKECGVKDGDK
IMHLQNNSLEWLITYFAIIRLGAIVVPLNFRFESADVLYAAEVCNPQVFLLGSEFLKVVQ
PIQQKLETIRKYICIGDTVPDDMIDYAKVDAYDDSSDAMVDVADHHDLAMMFTSGTTGKP
KPVMHTHFSMKNTAAGNGMSYFVEKNDNYLIFLPLFHSGTMFLWAPFYATGATGTILREF
NNARYIFDALAEEKCTDTLFVVPIAIMALNAIDDGTINLADYDLSAWRYMEIGAQPVPFD
IMKKLVETLPCGVSNIYGITEGGGGGLFNLYPEDVLKKPGSIGKPTYGVEAKIIDWDGSE
LPSGSVGELLFSTERMMKEYHGNPEMTAATIQDGWLRTGDLLKTDEEGFYYIVDRMKDMI
TSGGENIFPVEIEDALMDHPDIEDVACIGYPDDRLVEIVLAVVQLKAGKKMTEAELIEYA
KSKIATYKAPRKVIFDEIPRSATGKVMKPVLREKYTGRREAFKQLA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttctctaaatatgccgccataaacgctcgtcaccattccaacaagatttgcctt
attgagcgaactccctcgattgaaaaacgaaggacgctcacctggaagcagtttaatgac
gccatcaaccgcgttgccaattatctggccaaggaatgtggcgtcaaagacggtgataag
atcatgcaccttcaaaacaactctcttgaatggctgattacctattttgccatcattcgc
ctgggggcaatcgtcgtgcccctgaatttcaggtttgaaagcgccgatgtgttgtatgca
gcggaagtttgtaacccccaggtttttctcctcggctccgagtttttaaaggtggtgcag
ccaattcagcaaaaacttgaaacaatccgaaagtatatctgcatcggcgataccgttcct
gatgatatgatcgactatgcaaaagtagatgcatacgatgattcctcggatgcaatggtc
gatgtggcggaccatcatgatcttgccatgatgttcacctcgggtacgaccggaaagccc
aaaccggtaatgcacacccatttttccatgaaaaacacggctgccggaaacggcatgtcc
tattttgtcgaaaaaaatgacaactatctcatttttctgccgctgtttcacagcggtacc
atgtttttatgggcgccgttttacgccactggggcaacgggcaccatacttcgggaattc
aacaatgcaagatatatcttcgatgctctggcggaagaaaaatgcactgacacccttttt
gtcgtaccgatagccatcatggcactgaatgccattgacgacggcaccatcaacctggct
gactatgatttatcggcctggcgttacatggaaatcggtgctcagcccgtgcccttcgac
attatgaaaaagctggttgagaccctgccctgcggcgtatcaaacatttacggcattacg
gaaggtggcggcggaggcctgttcaatctctatcctgaagatgttttaaaaaaacccggc
tccattgggaaaccgacctatggcgtggaggcaaagattattgattgggacggcagtgaa
ctgcccagcggttcggtcggtgagttgctcttttcaacagaacgtatgatgaaagaatat
catggtaatccggaaatgaccgccgccaccattcaagacggatggctccggacgggcgat
ctgttgaaaaccgatgaagaaggtttttactacattgttgaccgaatgaaggatatgata
accagcggcggagaaaacatttttccggtggaaatcgaagatgcgctcatggatcaccct
gatatagaagatgtggcctgtatcggatatccggatgatcgcctggttgaaatcgtactg
gcggtggttcaactcaaagcgggcaaaaaaatgactgaagcggaacttatcgagtatgcc
aaatcaaaaatagcgacttacaaagcgcctcgcaaggttatttttgacgaaattccacgc
agcgcgaccggaaaagtgatgaagccggtgctcagagaaaaatatactggaagacgagaa
gcctttaaacagctcgcttaa

DBGET integrated database retrieval system