KEGG   Drosophila miranda: 108151999
Entry
108151999         CDS       T06132                                 

Definition
(RefSeq) caspase Dronc
  KO
K20009  caspase Dronc [EC:3.4.22.-]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108151999
   04215 Apoptosis - multiple species
    108151999
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108151999
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     108151999
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108151999
SSDB
Motif
Pfam: Peptidase_C14 CARD Death
Other DBs
NCBI-GeneID: 108151999
NCBI-ProteinID: XP_017136457
LinkDB
Position
XR
AA seq 457 aa
MQHSRREIGMLQKHRDHINEHLDELVKCTNYTRIREECVRINLLSPDMLRNVEDLSGAGF
NMSKEDSQLEQHRRLLIKITKRGPAAYNQLITVLRNVGSLQAVKLLEDVSEQNSGSPFIS
INERKITRKSADIVDTPSPSAVAVADRNGACVSKREYNEAGGPLIPYTEPVDGQKRDVKK
SDRVHTDEVVGTYNMQSQHYRGVLLMINIIDFPDTERKRNGAEVDSDSLIHLFREMGFTI
FAYNNMNQEQFFDTLGKVTSSKYAQQTECFVMVLMTHGERVGEMDKVEFGDGSVVDVHKI
KNYFQASVSPYLVHKPKVLIFPFCRGREPDLGQPINHFDSIGTAASRLSRQEETVVETEG
RPSTYTNVPSLSDTLVCYASTPGYVTHRDAESGSWYIQTFCDMMADHAHNTPVEDILKKT
NELVGHMRTSKGSMQTGSFDNLGFNKKLYFNPGFYTE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcagcattcgaggcgagaaatcggaatgctccaaaagcatcgcgatcacatcaacgag
cacctcgatgagctggtgaaatgcaccaactacacgcgcatcagggaggagtgtgttcga
ataaacctgttgtcgcccgacatgctgcgcaatgtcgaagacctcagcggcgcaggtttt
aacatgagcaaggaggacagccagctggagcagcacaggcggctcctaatcaagataacc
aagcgtggtccagcggcctacaaccagctcattactgtcctgcgcaatgtggggagtctt
caggcggttaagctgctggaggatgtttccgagcagaattccggctcccccttcatatcc
atcaacgagaggaagatcacccgcaagtcggccgacatagtggataccccgtcgccgtcg
gcggtggcggtggcggacagaaatggtgcatgtgtcagcaagagagaatacaatgaagca
ggtggaccgctaatcccctacacggagcccgttgacggacaaaagcgtgacgtcaagaag
tcggacagagtccacaccgacgaagtggttggcacgtacaacatgcagtcgcagcattat
cggggcgtgctgttgatgatcaatatcatagactttccagatactgagcgcaagaggaac
ggggccgaagtagacagcgattcgctgatccacctgttcagggaaatgggcttcacgata
ttcgcctacaacaacatgaaccaggagcagttcttcgacacactcggcaaggtcacttcg
tctaagtacgcacagcagaccgagtgctttgtcatggtgctgatgacgcacggcgagcgt
gtaggggaaatggataaagtggagtttggcgacggctcggtggtggatgtccacaagatc
aagaactatttccaggccagtgtgagcccgtacttggtgcacaagccaaaggtgctgatc
tttcccttttgtcgcggcagagaacccgatctcgggcagcccattaaccactttgactcc
ataggcactgcggcttcccggctgagtcgtcaggaggagactgttgttgagaccgagggc
agaccctccacctataccaatgtcccatccctgtctgacactctggtctgctatgccagc
accccgggttatgtgacccatcgcgacgccgagtcgggcagctggtacatccagacgttc
tgcgacatgatggccgaccacgcccataacacgcccgtggaggatatactgaagaagacc
aacgagctggtgggccacatgaggaccagcaagggctccatgcagacgggctccttcgat
aatctcggctttaataagaaactctacttcaatcccggcttctacacggaatag

DBGET integrated database retrieval system