KEGG   Drosophila miranda: 108152426
Entry
108152426         CDS       T06132                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 1 isoform X1
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108152426
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108152426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108152426
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    108152426
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108152426
Ubiquitin system [BR:dmn04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108152426
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_UBOX Rad50_zn_hook DUF3275
Other DBs
NCBI-GeneID: 108152426
NCBI-ProteinID: XP_017137232
LinkDB
Position
XR
AA seq 439 aa
MANVLTNPRYMYGPTAALELTAVLDQVDNNSNATQLFKNNIYNIMNEYNREEARLKTFAN
WPLAWLDKHQLARTGMFYTNDNDKVKCYFCEVEIGRWDLDDQPVPEHLRWSPNCPLLRRR
TTNNVPLNSEALERILPPISYDICGANESTVELRESAYAEGRIPMSHIAQSIATNTAVSP
LMSSIATSTAATQANGDVHPESCRQVASGNYFPEYPEYAVESTRLRTFEEWPRILKQKPM
QLAEAGFFYTGVGDRVRCFSCGGGLKDWDDNDEPWEQHALWLSQCRFVKLMKGQRYIDTV
AAKPDPVAEKEESSTSAAETPAAASSTTTTPAATATVEAPFGDVGPSAATRIYEKIVSSA
STTTATGAIPGTAGGPAPAPNGSPVIPEEKLCKICYAAEYNTAFLPCGHVVACAKCASSV
TKCPLCRKPFSDVMRVYFS
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcaaatgtattaaccaatccgaggtacatgtatggaccgactgctgcactcgagttg
acagcggttctcgaccaggtggacaacaattcgaatgctacgcagctgttcaagaacaac
atctacaacatcatgaacgagtacaatcgggaggaggcgcgcctgaaaaccttcgccaat
tggcctctggcgtggctcgacaagcatcagttggcccgaacgggcatgttctatacgaac
gataacgataaggtcaagtgctatttctgcgaggtggagatcgggcgctgggatctcgat
gatcaacctgtacctgagcacctgcgctggtcgcccaactgtccgctcctgcgccgtcgc
accaccaacaatgtgccgctgaacagcgaggccctcgaacgcatcctgccccccatcagc
tacgacatttgtggcgccaacgaatcgacggtcgagcttcgcgagagcgcctatgccgag
ggccgcatacccatgtcgcacattgcccagtccatcgccacgaataccgccgtatccccg
ctgatgagctccattgccacctcgacggcggccacccaggccaacggggatgtccatccg
gagtcgtgtcggcaggtagccagcggaaattattttcccgagtaccccgagtacgccgtg
gagtcgacgcgcctgcgcaccttcgaggagtggccgcgcatcctgaagcagaagccaatg
cagctcgccgaggcgggtttcttctacacgggcgtcggcgaccgcgtccgctgcttcagc
tgcggcggtggtctcaaggactgggacgacaacgacgagccctgggagcagcacgctctc
tggctgagccagtgccgcttcgtcaaactgatgaaggggcagcgatacatcgacacggtg
gctgccaagccggatccagtcgcagagaaagaagagagcagcacaagcgcagccgagacg
ccagctgcagcttcctccactacaacgacaccagccgcgacggcgacagtcgaggcccct
tttggcgatgtgggcccatcggcggccactcgcatatacgagaagatcgtgtcgagcgcc
agtaccaccacggcaacaggggccattcccggcacggctggaggtcccgcaccggcgccc
aacggctcgccggtcattcccgaggagaagctctgcaagatctgttatgccgcagaatac
aacacggcgtttttaccctgcggccatgtggtggcctgcgccaagtgcgcctcgtccgtg
accaagtgcccgttatgccggaagcccttctccgatgtgatgcgtgtatatttttcttaa

DBGET integrated database retrieval system