KEGG   Drosophila miranda: 108153017
Entry
108153017         CDS       T06132                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dmn  Drosophila miranda
Pathway
dmn04013  MAPK signaling pathway - fly
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108153017
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108153017
   04215 Apoptosis - multiple species
    108153017
SSDB
Other DBs
NCBI-GeneID: 108153017
NCBI-ProteinID: XP_017138251
LinkDB
Position
XR
AA seq 399 aa
MAVPFYLPEGGSDDIASSGASGSSSGASSSGASTSSAGSSDGASSIASQSPNTTTSATQT
PMQSPLPTDQVLYALCQWVRHYHSQTQQNAAQIFQYPPPPSPSCNYTVGDVFFPHGPPPV
PPRTPRTSVSFAAGEEYNFFRQQTQPPYPAPSTPQPMPPQPPQSAPPMHYSHSFPQQSPH
LLQHHHPASVYGMGQHQPGPGSYYATYTPPPTPNTANAGTSTSSAAFGWHSHGPQLASTP
LTAPMGSKMRLQRSQSDAARRKRLTSTGEDEREYQSDHETSWDDEYDDRYDNFTAGRERL
QEFNGRIPPRKKKNSHSSSSSHSHSHSNNNPISQNNFQLHSSNAECSSSASGSASHGSNS
QREREQRAEAEKKKPQVFTWPTVVTVFVLAMGCGFFAAR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatctgcccgagggcggatccgatgacatcgcctcgtcgggcgcc
tcgggctcctcttcgggcgcatcctcgtcgggtgcctccacctcgtcggcaggttcctcg
gacggcgccagcagcattgcctcccagtccccgaacaccaccacatcggccacgcagacg
ccgatgcagtccccactgcccacggaccaggtgctctacgccctctgccagtgggtgcgc
cactatcacagccaaacccaacagaacgccgcgcagatcttccagtacccgccgccgccg
agtccctcctgcaactatacggtcggcgatgtcttcttcccccacggcccaccgccagtg
ccgccgcggacaccgcgcaccagcgtcagctttgccgccggcgaggagtacaacttcttc
cggcagcagacacagccgccgtatccggcgccgtccacgccgcagccaatgccaccgcag
ccgccgcagtcggcgccaccgatgcactacagccacagcttcccgcagcagtcgccgcac
ttgctgcagcaccaccatcccgcctccgtctatggcatggggcagcaccagccgggtccc
ggctcctactacgccacctacacaccgccccccacaccgaacacggccaatgccggcacc
tcgacctcatcggcggcctttgggtggcacagccatggcccccagctggcatcgacaccg
ctgacggcgccaatgggctccaagatgcggctgcagcgcagccagtcggatgcagccaga
cgcaagcgattgacctcgacgggcgaggatgagcgcgagtatcagagcgatcatgagacc
agctgggatgatgagtacgatgatcgttatgacaattttacggccggacgggagcgtctg
caggagttcaacggacggataccaccacggaagaagaagaacagtcacagcagcagcagc
agccacagccacagccacagcaacaacaatccaatcagccaaaataatttccaactccat
tcatcgaatgccgagtgcagcagcagcgccagcggcagtgccagccacggcagcaacagt
cagagagagcgggagcagcgagcggaggccgagaagaagaaaccgcaggtcttcacctgg
ccgaccgttgtgaccgtgttcgtgctggccatgggatgcggcttctttgcggcgcgatga

DBGET integrated database retrieval system