KEGG   Drosophila miranda: 108153528
Entry
108153528         CDS       T06132                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108153528
   04215 Apoptosis - multiple species
    108153528
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    108153528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108153528
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     108153528
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108153528
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108153528
NCBI-ProteinID: XP_017139082
LinkDB
Position
XL
AA seq 534 aa
MNRSVCYFSLFRVFCTSPPNTMSGHNILTQLESIHVLDLPYVERDLNFAQMVSLSFLLYG
DEHSTATYILQKLLVLARATASDWSHSDILSQYAKSKPQTWRKYLVEALCIIGARQVLRK
LGLCWQELRTHYLPHVGEISLHIHPLLKSLYTICEELTLAQRGRMVLDIKEKNSVGDPLR
FYDPEYLEIFLLDWLTRRLIRLGDINANGSDVQLLIEYFKFNDLHAQATLLVKTVNTNAT
SSCSPATPNVLLPMDGNGIANESSSPTAAASRPRAKNALQLSREKAGIALIINQQKFYRD
VSDDHKVYLPPIELPPRNGTDMDKQRLTNVFSKLGYRVEAHDNLDHLSMLHHIRQACERS
LLLDSLVVCILSHGFEEAVYGANSIALRISDIENVLCSYENLYEKPKLVVIQACQENKED
QENNALPYKIDASTKSPFQYLNMLRAMSTVPGFPALRHTQTGSWFIQCLCDAIVEHSNSD
HIADILTIVINNVANKRGNKNETMVPWTGGALRQHVYFPPTSATDKVVPDSPGQ
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaacagatcagtgtgttacttttcgctatttcgcgttttctgtacttctccaccaaac
accatgagcggccacaatatcttgacgcaattggagagcatccatgtcctcgatctgccc
tatgtggagcgcgatctgaactttgctcaaatggtgagcctgtccttcctgctgtatggc
gacgagcattccactgccacgtatattttgcaaaagctcctggtgttggcccgcgccact
gcctccgactggtcgcacagcgacatcttgagccagtatgccaaatccaagccccaaacc
tggcgcaaatatctcgtggaggctctgtgcatcatcggggcgcggcaggtgctgcgcaaa
ctcggcctctgctggcaggagctgcgcacgcactacctaccccacgttggcgaaatcagt
ctgcatatccatccgctgttaaagagcctgtacacgatctgtgaggagctgacgctggcc
cagaggggtcgcatggtgcttgatatcaaggagaagaacagcgtcggggatccactgcgc
ttctatgaccctgaatatctggagatctttttacttgactggctgacgcgacgtctgata
cggctgggcgacatcaatgccaacggcagtgatgttcagctgctaatcgaatacttcaag
ttcaacgatctgcatgcccaggccacgttgctagtcaaaacggtcaacactaatgccacc
tccagctgctcccctgcaacaccgaatgtgttgcttccaatggacggcaatggcattgcc
aacgaaagctccagccctacggcggctgcgtcccggccccgggccaagaatgcacttcag
ctgagccgcgagaaggctggcattgcgctaataatcaaccagcagaagttttaccgggat
gtcagcgatgatcacaaggtctacttgccgccaattgagttgccgccacgcaatggcacc
gatatggacaagcagcggctaactaatgtcttctccaagcttggctacagggttgaggcc
cacgataatctcgaccatctgtcaatgctccatcatatacggcaggcctgtgagcggtcc
ctgctgctcgattctctggtggtgtgtattctgtcgcacggctttgaggaggctgtctat
ggcgcgaatagcattgctttgcggatatcggatatcgagaatgtactctgtagctatgaa
aatctgtacgaaaagccaaagcttgtcgtcatccaggcgtgtcaggaaaacaaggaggac
caggaaaacaatgccctgccgtacaagatcgatgccagcacaaaatcacccttccagtac
ttaaatatgctgcgagccatgtccactgtgcccggttttccagcgttgcgacacacccag
acaggcagctggtttattcaatgtctgtgcgatgccattgtcgagcattcgaatagcgat
catattgctgacattctgacgattgtcatcaataatgtggccaacaaacggggcaacaaa
aacgagaccatggtaccctggaccggcggtgcgctacgacagcacgtttactttccgccc
accagcgccactgacaaggtggttccagatagccccggtcagtag

DBGET integrated database retrieval system