KEGG   Drosophila miranda: 108154832
Entry
108154832         CDS       T06132                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 6 isoform X1
  KO
K10586  baculoviral IAP repeat-containing protein 6 (apollon) [EC:2.3.2.23]
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108154832
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108154832
   04215 Apoptosis - multiple species
    108154832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108154832
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    108154832
Enzymes [BR:dmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     108154832
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108154832
Ubiquitin system [BR:dmn04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   108154832
SSDB
Motif
Pfam: UQ_con BIRC6 BIR UEV
Other DBs
NCBI-GeneID: 108154832
NCBI-ProteinID: XP_017140724
LinkDB
Position
2
AA seq 5091 aa
MATEQRILKQDGYLDVGDNSGAPARPFEMRNILYHPQLNVLLLFGCNNVVKVLDVNSGVV
LQTYRLSKNGESVVHGRYMPLQDKILFWDGHNVGLRGDYNGVLLLDTILQAPIGQNDDYI
KLEIILSEAIIFQHCINDLESEGLECPCDISNELTQKIKKAQKNAKKGIKAQRWNTICLE
VPYSSMKLVANNVVILLKRLERHIPVLAIASAINERLTDMMMGSRVPDFGWNFSNFKRVL
MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCNVCLVCWEKTD
EPWSEHERHSPICPFVKGEYTQNVPLSITYATSPALSAPGLGFDIISNSDYANVLCTSCS
QTGELSVWSIERHLRLMYSFHVQTLLKDVFEESFEWARVTAICVLPNARARTKVNYVYSA
ANYGGSSSGSGGGGSHAGSNQTSGKFGSVNAQHITSTSTLRAGVVGSKIVLGVSVRQSSG
EVALRMVVLNIVEVDRQSETSASVSNDSGSVSSVGGNLKKTSSHIGTGTTSSSDANGGGG
GGGVGNVTQVNLESKDDDNKAMTPYEKFADGFDSNGFVSALMTYNKNNGTSQPLDDASVL
YDFDLCTLSQILDHNLEDPLGGLMVTSNTVNVGNLPAMGNDMDKLVDDAEMTHQNINNNN
NNNNNNDGNSLGGSTNNNNNNNNNIMLNGSNSSSDKLTASEEIDCVVESWTSVKRTNALD
GGAGSGENGDVASAAQEIVEIAEIMPSTPKCNQLLVKLLRTKAPETECSKIIMATVAKED
EEEEQEADDRMDTDNNADDSVAAQLLLFDYEDQQISHDYTLAMTFSRAKCPKQLCVLPNF
NSAPEHKDKGAICVVCADGSVEIYSLADFQTTNVIEQEGEHFESVVYCRNMDRLCCCSRQ
GGLLFYSLNECDNDSGDELLELEDECSTTLTQAQAGELSVTDGTGRTIAIGAEKHGKLLT
VNDSISVDVGTETGASTSGAAAPHQSVHVQTSPSAQSMGSNNANFLAYKTSDLTLDDLRV
LHALTQFDDKLTLYSAEVPSCWNDLGQVQKQRKQSQNMRHGGDERDYTRTWRLHNDATTW
DEHIIELNLAQPVSLGHIDLKFTVFQQCPNPAAIQVTLLKQNTNGFGYRMKGPHASYKPY
AIDDNIDLSYIANENPVLSEEYLLAHNAEVLAGPIELSSCIDVCDQGGTATLTSPKLFKT
RTRNFLLHIKTVADPSKEGQTKTRASTPKRHKRRSHHIEMLVKDQKPNMHSNPIPKSAAS
EYELKKAALKAALKLESQSHLQVTLKKIQKAGFNIKHLNKLNVIKASVGDGASASSQDPS
EKLSEQTSPKPPPDSLVSGELIREGCDWLHEISISVRAVKSQSRISNARMQRIAMLESNG
LMEQLLRIASDSGSTPLTKNLALDILNWICFIRLNRFRSPKSERLKDQINKQTAANIPDL
LAQQFECISLAEKHIEQLMRNCIIYSERSTAHKCSKLIIMLTEGVTNLPTELQLFTTLDY
TIKEAITNTFHELPRAQTGSVVRWYTMLTCATSTAESNNSISEQAINLLKEIAGEIDKRW
DPCCALLSTRFGLYGFPFEPEIFDFDFPNLNRHGISSPVALTNVIRSNSAILKVTALDIK
RLSSIDGVDFRTFPYLIRGKSISNQLRGLLEVVQLHFSCVQTSEATRIDNIDSVGGTAAA
SLVIDDAMIPKLVVAKEKNDDVQLNDLVNDVESMVEEITEKEGKIDFDSFGMVNGFKEKS
VSSLTDLEHALKEEVKNEKAAILDHLKLSQLLPDLSLLESFILKKQQYAMVASSKLDNWE
MAPTSKTQLELDTLKPFAGMLPTQEQAAAAAGADPAPAPTEPQQAGVATGGTGGTGDNTV
VLDDAAESEKIMENLSDNPCQPIAWHKLITPPPKQMIIIDRMHSGARRFVVLDFGQHILL
TDVVIPPCDELTSLNIDIWCFDEETDCTRLVQMADIQTKTLVLSDIQPPPICRFLKVTII
GRIGMSSTKCKVPLGRFFGHPVVLEHDGYGDQLMRFIKQPKQNLQAQLKSLNALYEDVHC
RYSLASTKLMDVLAPMRHSELSNVAHLQAFINKQRDEELGNLDNSNKVVSLYDECMLLQY
QINVIRNVVLRLERAVNPHLVCTPPPNSGPLTEETLRTASRDKLRVLSLTLVEVLLHFSI
EYGIKNILPVYQRFNAATAKALFNSLVVYGDAQLQLATCSLLVVMCCFQPWWGDFLAETF
CSLFSAQNCKAFPQDRIFFLLTYLGRRSIGMGACRSIVIDAVLKTLLKLLAPISPHYKFQ
SEQPSTSASASERSATMGSTSDLQLITWLLLFLSVCLDDNERKDKSAERWDFMSCESDFT
KTRPNNVPNSKQLRCFKKRIIQQSKYSVPPYTDWGKKIYMIQNEVITNHPGIFMELSTKA
KSGATKTQTTASKINMAAANMFMGSGSLPTCSSAKKTAATSTSSTSSPKHADSGGGGSSG
SETERDSNFDKGLKTLRMANIKVVIRGLFALLLEMDFDCNMDQFLLTCKVIARLVAACRP
SVQLCKIVTTAQLEQLVRLAVWNDQQQPWAVHAITCLLQDLLDADKQYRDSDVTPTNDAP
PRPMEPEVQAARDLFSDFTSSSSSCSEAQFEMLMPTAREFYQEAVKYNYLPSLIECDDAE
FDDMLNDIDMIERTKPVTKKESNALCKNTFNFFCKSISVAMDSRLDVGLELHVETQLRRL
TNRTSLDLYASLPQVLTNEFVSPAPEAAPWPEYLTQLWSGSEYNGRNTYVMFKNVFDSIL
ADLHYEDTWVHLEQVLQMWLTLNCELAEKPYTTGISQTDVPRIPFGANAVQGLLLALAWH
NDIKLRTWCLGFQCLLLACNSQPIGDDADCTRINEVIVNDENFEKMLLRFFSGYGMSSSI
ITNRCAGPTICKHLHDLLLWMHGKTDSSGIPCKRQLKDILLHVVLQLVQPGGAISNQQGP
IDAQNQLVRDLLMMPTDKGDLNIALKITESVSFLVFNNISNGEKLQCQRGNESNNPGNNF
SNLFANVLGSENPIKQNATICDNSLIINLLRLSSHMVLTEMPRQPSEVTIPEEEELSTES
QTDETKAEQLNTEGHRSKVPCIADWVLRQFPTMKRLFGTLSQCSTITFTMMSSGGFLLLK
SNTVLDDPQTIADAVFSLMITLSDKASNPRLVVAPICQYLEETTIQRNATLPRLPLSEPF
LWYISKVLEVTAAVQTFTQLGGIHIICHNLVRLNKTIINMQPGLISLIMQHMTRNTRLKL
NTHMAANSACKKTTPSTGATSAPATQHPPRSGAQYDGLINFAPFSHIVSENDAAQSAELL
ISNPNATHRRPRSPAWSYMFYPNETHVDLTITLPTAILLKEVQLVPHTSNLASCPSAVAL
ELSRDYGVGSIPIGAPMATTGLTCIRLKLSKAEVATSIVIRLYKPKDCGNVGLVQIAVLG
QTIFGNRMQGLRSQGLFMDSLTSCSSPLQTAAMSTIDADAMPEDDAFAKTSIGWVRILSR
CFHMAALQPDTKLADLIAAYPASYPGFLEACCSLLNIMPMIPSLAQQHLETILLKLGAYN
HELSLQLLRTLLWHTTPQVFKLSSDAVCDLIHEVVTGSSKHLLDKLRVLIDWIMQLHDNY
SKQARCNNPQSGFVKVIASILWRVHVQYQLPELPHLITSALFETCFEWVSVLEQDEPLKS
SFDSLLCALCFIKPELFNQLLVKLGVKLEPPARGQTDDSKVQSGSAWFRREGSENLTVLL
ERPTFLKTLALACQSPAAVYQMLDSGLPKLLAHAVYEYCTHLLAGLEQEAPSLAAAPAPA
PVPAQAAVPTDGQQGSSSLTDFDKAEAPPSASPPNLNTPLLSSSVVPKVLDFFAECCAEG
PMRNWLGTMQGSVFWKPLLQLLCHTHSSQFSKTLPMQQSFIRLERSTINFLTRVSACHPE
NQEVLTSLLIGAIICKPLRSVQGTRPTISGFTRQLVLQLLLENEHITVAVRSQNPLQRRD
TLSAIMGGGGSGSGSAASNSISSTSLPVAAVNNHPAKRSSAHYMLFNVTTSTTCQEILMN
CVSAYSNLVYTTSTDPRASEPSGSGNGSGSGSGGTGAPGAAVSSKFVNPKQDKNWDQNCY
INLSNVDLSSLEFLSVGAAVAAKDKRIKDAKNLLAVNKDKETQTTSSTSNVFYVEEFLLQ
SNWSKKNQLVIADYPNVVLSGDATISQVLATLEAAGHSLAIPCLTLDLVPLQHGDETIDD
KKTKAACTEPLPSPLQRFSSNGGLSLLAHYLPTVYPEHSGRKTVMMVTEKEKSPPLTDWV
KLEPNDEIYEDLEDTICEPVAKQTPVSSVPQHSLAAFGLFLRLPAYSDVLLRDKLRAQCL
LRLVLGVTGDGEGNDIYSLSLAPSLHTLPFEVFRQLLDTVPLSTDDGMLLRRVVIEVGAM
HLVLNCLGIFSHQSHNNRIGAPINQPSPSGSASGGGNGSTTKTTTNGTAAGAKSSGGDEP
TPSGTSDDKSHMYWAKGTGFGTGSTTQSWNVEQALLRQKSEEEHVTVLLLVLASYINPGD
CIPSEMCGEDILAYHDVRDVTGELPALFQTLLKQSCLIPALSSYLRNDSVLDITRHIPLY
RAILKLLRALSLSKSLVSLLQPAPSACGEGKPPIAELLTNMKTCVDTYAKRLKVNKKSNI
KGQTQQLTFNIDDGDDEGLALLIPDIQETSVLVQKTTDADALINMQSSSEDGSGQLERPL
SKSVEQRYLELMKKRQFDTFDMIVESENNSFRFVVSHHFEKIVRLAGDRYHPSRVKRLAQ
EAVTLSTSLPLSYSSSVFVRCDTDRLDVMKVLITGPSDTPYANGCFEFDVFFPPDYPNLP
MIINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWNAQTSSFLQVLVSIQSLIL
VPEPYFNEPGFERSRGTPTGTNSSREYNSNIYQACVRWAMLEQIRNPSPCFKDVIHKHFW
MKREEVCTQIEGWIEELSKAQYTERAGRTISFNSMVLRRHYRHLREELAKLKPPHGLEDL
DAPFNPVSTLPPMDVSAAPVATTTANVQVGTDGPIVHELNLMTDDGDDSDNGPCILDPVS
GVLKGEEELVEILSDTENESSVWQEKEEEEEDEGDVDGDGDGDGDGDGEEE
NT seq 15276 nt   +upstreamnt  +downstreamnt
atggccacagagcagcgtattcttaagcaagacgggtacttggatgtgggcgacaatagc
ggagcacccgctcgtccgttcgagatgcgcaacatcctctaccatccgcaattgaatgtg
ctgctgttgttcggctgcaataatgttgtgaaggttctggatgtcaattctggagttgtt
ttgcagacttatagattgagtaaaaatggcgagagcgtcgttcacggtcgttacatgccc
ttgcaagataaaatcttgttctgggatggccacaatgtgggtttgcgcggcgactacaat
ggcgtcctgctgctggataccatattgcaggcgcccattgggcagaacgacgactacatt
aagctggagatcatattgtccgaggcgatcatcttccagcactgcatcaacgatctggag
agcgagggcctcgagtgtccctgcgacattagcaacgagctaacccagaagataaaaaag
gcccagaagaatgccaagaagggcatcaaggcccagcgatggaatacaatatgtctggag
gtgccctattccagcatgaagctggtggccaacaacgtggtcatcctgctgaagcgtctg
gagcgtcacattccagtgcttgccatagcatccgccatcaatgagcggctcacagacatg
atgatgggctcgcgggtgcccgatttcggctggaatttcagcaactttaagcgtgtgctc
atgcactcagaggccgtgcgtcgccagacattcgagaagtggccccacatggactacaag
tgggcgctgccggatcaaatggcacaggccggcttctaccatcagccgtcgtcctccggg
gaggatcgtgccatgtgcttcacgtgcaacgtgtgtctggtttgctgggagaagaccgac
gagccctggagcgagcacgagcgccattcgcccatctgtccgtttgtcaagggcgagtac
acgcagaatgtgcccctgtccatcacgtatgccaccagtccagccctgtcggcgcctggc
ctcggcttcgacatcatctcaaacagcgactatgcgaatgtgctgtgcaccagctgctct
cagacgggcgagctgagcgtctggagcattgagcgtcatctgcggctgatgtacagcttc
cacgtgcagaccctgctcaaggatgtgttcgaggagagcttcgagtgggcccgcgtgacg
gccatctgtgttctgcccaatgcccgagcccgcaccaaggtcaactacgtctattccgcc
gccaattatggtggctctagcagcggcagcggcggcggcggctcgcatgctggctccaat
cagaccagtggcaaatttggcagcgtcaatgcccagcatataacctccacatccacactg
cgcgcgggcgtggtgggttccaagattgtgctgggcgtcagtgtgcgccagagcagcggc
gaggtggccctgcgcatggtggtgctgaatattgtggaggtggatcgccagagcgagact
tcggccagcgtgagcaacgacagtggcagcgtctccagcgttgggggaaatctcaagaag
acctcttcacatatcggtaccggaaccacctcctcgagtgatgccaacggtgggggcggg
ggcgggggcgtgggaaacgtcacccaagtgaatctcgagtccaaggacgatgacaacaag
gccatgacaccgtacgagaaattcgccgatggcttcgatagcaatggctttgtgtccgcc
ttgatgacctacaacaagaacaatggcaccagccagcccttggacgatgcgtccgtcttg
tatgactttgatctgtgcactctgtcgcagatactcgatcataatcttgaggatcctctt
ggcggtctgatggtcacctcaaacaccgtcaatgtgggcaatcttcctgccatgggcaat
gacatggacaagcttgtcgacgatgccgagatgacacatcagaatatcaacaacaacaac
aataataacaacaacaacgatggcaactctttgggcggcagcaccaataacaacaataat
aacaacaacaacataatgctaaatggaagcaacagcagcagcgacaaactgacggccagc
gaggagatcgactgtgtcgtcgagagctggaccagcgtgaagcgcacgaatgccttggac
gggggggcgggaagcggcgagaatggtgacgttgccagtgcggcccaagagatcgttgag
atagccgagataatgccctcaacaccgaaatgcaaccagctgctggtcaagctgttgcgc
accaaggccccagaaacggagtgcagtaagatcattatggccacggtggccaaagaggat
gaggaggaggaacaggaggcagacgaccgcatggatacggacaacaatgccgatgacagt
gtggccgctcagcttttactgttcgactacgaggatcagcagatatcccatgactacacc
ctggccatgaccttcagccgggccaagtgtcccaaacagctgtgcgtcctgcccaatttc
aactccgccccggagcacaaggataagggcgccatttgtgtggtgtgtgccgatggcagc
gtggaaatctactcgctggcagacttccagaccaccaacgtgatcgagcaggagggcgag
cactttgagtccgttgtctactgccgcaacatggacaggctgtgctgttgctcccgccag
ggcggtttgctcttctactcgctgaacgaatgcgacaacgattccggggacgaactgctc
gagctggaggacgagtgcagcacaaccctaacgcaggcgcaggcaggagaactgagtgtc
acagatggcactggtcgcactatcgcgatcggtgccgagaagcacggcaagctgttgacc
gtgaacgatagcataagtgtggatgtgggcaccgaaacgggggcatccacatcgggagct
gccgccccacaccaaagtgtccacgtccagacctcgccctcggcccagtcgatgggctcg
aacaatgccaactttctggcctacaaaacaagcgacttgacgctcgacgatctgcgtgtg
ctccatgccctcacgcagttcgatgacaagctgacgctctactcggcggaagtgcccagc
tgctggaacgatctggggcaggtgcagaagcagcgcaagcagtcccagaacatgcggcat
ggcggcgatgagcgtgactacacgcgcacctggcgattgcacaacgatgctaccacttgg
gatgagcacatcattgagctcaatttggcacagcccgtgtctctgggtcacattgatctg
aagttcacggtgttccagcaatgccccaatccggcggccatccaggtcaccctgctcaag
cagaacacgaatggctttggctatcgcatgaagggaccgcatgccagctacaagccgtat
gccattgacgacaacattgatctctcctacattgccaatgaaaatcccgtactcagcgag
gaatatctactggcccacaatgcagaggttctggccggtcccatcgagctctcgtcctgc
attgatgtctgcgatcaggggggcacggcaacgctgacctcgccgaagctcttcaagacg
cgtacccgtaactttttgctgcacatcaagacagtggcggatccatccaaagagggacag
accaagacgagggcatccactccgaaacggcacaagcgccgatcccatcatatagagatg
ttggttaaagaccaaaaaccaaatatgcattcgaatccaatccctaagagtgcggcgtcc
gagtacgaattgaagaaggcagctctgaaggcagctctgaaactcgaaagccaaagccat
ctgcaagtcacacttaagaaaatccaaaaagccggctttaatattaaacatttgaacaag
ttaaatgtgatcaaagcaagcgttggcgatggagctagtgcttcttctcaagatccaagc
gaaaagctttcagaacaaacttcgccaaagccgccgcccgattctcttgtttctggggaa
ctgattagggaaggctgcgactggctgcacgagatctccatcagtgtgagggccgtcaag
tcgcagagtcgcatcagcaatgcgagaatgcagcgcatagccatgctggagagcaatggt
ttaatggagcagctgctacgcattgccagcgattcgggatccacgccgctgaccaagaac
ctggccctcgacatcctcaactggatatgcttcattcgcctgaaccgcttccgttcgccc
aaatccgagcggctaaaggatcagatcaacaagcagacggcagccaatatacccgatctg
ctggcccagcagttcgagtgcatttccctggccgagaagcatattgagcagctgatgagg
aactgcatcatctacagcgagcgcagcacggcccacaagtgctccaagctgataataatg
cttacagagggcgtcaccaatctacccacggagctgcagctctttaccacgctggactac
accattaaggaggccatcacgaataccttccacgagctgccccgtgcccagaccggcagt
gttgtgcgctggtataccatgctcacgtgcgccacatccaccgcggagtcgaacaacagc
atatcagagcaggccatcaatttgctgaaggaaatagccggggagatagacaagcgctgg
gatccctgctgcgccctgttgagcacacgctttggcctctacgggttcccctttgagccg
gagatctttgactttgatttccccaatctcaatcggcacggcatcagctcccccgtggcc
ctgacgaatgtgatacgcagcaattcggcgatcctcaaagtgacggcactggacattaag
cgtttgagttcgattgatggcgtcgactttcgcacttttccctatcttatacgagggaag
agcatcagcaatcagctgcgcggcctgctcgaggtggtccaactgcatttcagttgtgtg
caaacgtcggaggccactcgcatcgacaacattgacagtgtgggtggcacagccgccgcc
agtctagtgatagacgatgcgatgatacccaagctggtggtggccaaggaaaagaacgat
gatgtgcagctgaacgatctggtcaacgatgtggagtccatggtggaggaaatcaccgag
aaggagggaaagatcgactttgattcgttcggcatggtcaatggtttcaaggaaaagtct
gtttcctcgctcaccgacctggagcatgccctcaaggaggaggttaagaacgagaaggcc
gccattttggaccatctgaagctgtcacagctcctgcccgatctgtccctgctcgaaagc
tttattctcaagaagcaacagtatgcgatggtggcttccagcaagctggacaactgggaa
atggcaccgacatccaagactcagttggaactggataccttgaagccgtttgctggaatg
ttgccgacacaggaacaggcagcagcagctgctggagcagacccagccccagcgccaaca
gagccacagcaggcaggagtcgcaacaggcggcacaggggggactggcgacaacactgtc
gttctcgatgatgccgccgaatccgaaaaaattatggaaaatctcagcgataatccgtgt
cagccgattgcctggcacaagctgatcacgccgccgcccaaacaaatgattatcatcgat
cgcatgcactctggcgcgaggcggtttgtggtgcttgactttggccagcacatcctcctc
acggacgtggtgatacccccctgcgacgagctcacgtccctgaacatcgacatctggtgc
tttgacgaggagacggactgcacgcgtctcgtccagatggcggatatccagaccaagacg
ctggtgttgagcgacatacagccgccgccgatctgtcgcttcctgaaggtgaccatcatc
gggcgcatcgggatgtcgtccaccaagtgcaaggtgccgctgggccggttctttggccat
cccgttgtgctcgagcacgacggctatggggatcagttgatgcgcttcatcaagcagccc
aaacagaacctgcaggcacagctcaagtcgctgaatgccttgtacgaggacgtccactgt
cgctacagtttggccagcaccaagctgatggatgtcctggcgcccatgcgccacagcgag
ctctcgaatgtggcccatctgcaggcgttcatcaacaagcagcgcgacgaggagctcggc
aatctggacaacagcaacaaggtggtgtccctctacgacgagtgcatgctgctccagtac
cagatcaatgtcatccggaacgtggtgctgcgcctggagcgggcagtcaatccccatttg
gtgtgcacgcccccgcccaactcgggtccgctcacagaggaaacgctgcgtactgcctcg
cgggacaagctgcgtgtcctcagcctcactttggtggaggttctgctgcacttctccatc
gaatacggcatcaagaacatcctgcccgtctatcagcgcttcaatgcggccacagccaag
gctctgttcaactccctggtggtctatggcgatgcccagctgcagctggccacctgctcc
ctgctggtggttatgtgctgcttccagccgtggtggggagacttcctggcggagaccttt
tgcagcctcttttctgcacagaactgcaaggcatttccacaggatcgcatattctttctg
ctgacgtatctgggacgccgcagcattggaatgggcgcctgtcgctcgattgtgattgat
gccgtgctcaagaccctgctgaagctgctggcccccatttcgccacactacaaattccag
tcggagcagccgagcacctcggccagtgcctccgagcgtagcgccaccatgggcagcaca
tccgatctgcagctgatcacctggctgctcctcttcctctccgtgtgtctggacgacaac
gagcgcaaggataaatctgccgaacgatgggatttcatgagctgcgagagtgacttcacc
aagacacggcccaacaatgtgccaaacagcaaacagttgcgctgcttcaagaagcgcatc
atccaacagagcaagtactccgttccgccctacacggactggggcaagaagatatacatg
attcaaaacgaggtaataacaaatcatcctggcatatttatggagctctccaccaaagcc
aagagtggcgccaccaaaacccagacaacagccagcaagatcaatatggctgcggccaat
atgtttatgggtagtggcagcctgccaacttgcagcagtgccaaaaagactgcggccacg
tccacgtcctcgacatcgtcgcccaagcatgcggatagcggcggaggaggctcctctggc
agcgagaccgagcgcgacagcaactttgacaagggcctcaagacgctgcgaatggccaat
ataaaggtcgtgatccgtgggctgtttgccctgctgctggagatggactttgactgcaat
atggaccagtttctgctcacctgcaaggtgattgctcgcctggtggccgcctgccgtccc
tcagtgcagctgtgcaagattgtgaccaccgcgcagctggagcagctcgtacgcctggcc
gtgtggaacgatcagcagcagccctgggctgtgcatgccatcacatgtctgctgcaggat
ctgctcgatgcggacaagcagtaccgggacagcgatgtgacgcccaccaacgatgcaccg
ccacggcccatggagccagaggtgcaggcagcacgcgatcttttcagtgattttacatca
tcgtcttcctcatgctccgaggcacagttcgagatgctaatgccgacagctcgagagttt
tatcaggaggccgttaaatacaactacttgccctctttgatcgaatgcgatgatgcggag
ttcgacgacatgctcaacgacattgacatgatagagcgcacaaagccggtgaccaagaag
gagagcaatgccctgtgcaagaacacctttaacttcttctgcaagtccatttcggtggct
atggactcgcggctggatgtgggcctggagctgcatgtggagacgcagctgagacgcctc
acaaatcgcacctccctggacctgtacgcctccctgccgcaggtgctgacaaacgagttt
gtttcgccggcgcccgaggcggccccctggccagagtacttgacccagctgtggtccgga
tcggagtacaatggtcgaaacacgtatgtgatgttcaagaacgtcttcgactcgatactg
gccgatctgcactacgaggacacgtgggtgcatctggagcaggtgctgcagatgtggctg
acgctcaactgcgagctggccgagaagccctacacgacgggcatctcccagacggacgtg
cccaggataccgttcggagcgaatgcagtccaaggactgctgctggctctggcctggcac
aacgacatcaagctgcgcacctggtgcctgggcttccagtgtctgctgctcgcctgcaac
tcccagccgatcggggacgatgccgactgcacgcgaatcaatgaggtgattgtgaatgac
gagaactttgagaagatgctgctgcgtttcttctccggctacggcatgagctcatccata
atcactaatcgctgtgctggacccaccatttgcaagcatctgcatgatctactgctctgg
atgcatggcaagaccgacagcagtggcattccctgcaaacgccagctgaaggacatcctg
cttcatgtcgtgctgcagctggtgcagcccggtggagccattagcaaccagcagggcccc
atagatgcccagaatcagttggtgcgcgacctgctgatgatgcccaccgacaagggagat
ctaaacatagccctcaagatcaccgaaagtgtttctttcctggtcttcaacaacatttcc
aatggcgagaaactgcagtgccagcgtggcaatgagagcaacaatccgggcaacaacttt
agcaatctgtttgcgaatgtcctgggatcggagaatcccatcaagcagaatgccacgata
tgcgacaattcgctgatcataaatctgcttcgattgtcctctcacatggtgctcaccgag
atgcccaggcagccaagcgaggtaaccattcccgaggaggaggagctctccactgaaagc
cagacggatgagaccaaggcagagcaactgaatacggaagggcatcgcagcaaagtgccc
tgcatagccgattgggtgctacgccagttcccaacgatgaaacgtctctttggcacgctc
tcccagtgctccacgattacgttcacgatgatgtcctcgggtggctttctgttgctcaag
tcgaacaccgtactcgatgatccccagacgattgccgacgccgtcttcagtctgatgata
acactcagcgacaaggcctccaatccccgtctggtagtggcgcccatctgccagtacctc
gaagagaccaccattcagcggaatgcaacgctgccgcgtctgccgctatcggagcccttc
ctgtggtacatctccaaggtgctagaggtgacggcagccgtgcagaccttcacccagctg
ggcggcatacacattatctgccacaatttggtgcggctcaataagactatcatcaacatg
cagccaggattgatctcactgattatgcagcacatgacgcggaatactcgcctcaagctg
aacacccacatggccgccaacagtgcctgtaagaagactacccccagtacgggcgccaca
tcggcgcctgccacccagcatccaccgcgcagcggggcccagtacgacgggctcattaat
ttcgcccccttctcgcacatcgtgtccgagaatgatgcggcccaaagcgccgagttgctc
atatcgaatccgaatgcaacgcacaggcgtccgcgctccccggcctggagctacatgttc
tacccgaacgaaacgcatgtcgatctgaccatcacgctgcccacggccattctgctgaag
gaagtgcaactggtgccgcacacctccaatctggcctcctgcccctcggccgtggccctc
gagctgtcgcgcgactatggcgtgggctccattccaataggtgcgcccatggccaccaca
ggactcacctgcatccgcctcaagctgtccaaggcggaggtggccaccagcattgtgatc
agactgtacaaacccaaggactgcgggaacgtgggtctggtgcagattgccgtgctcggc
cagacaatattcggtaatcgcatgcaagggctgcgctcccaggggctgttcatggactcg
ctgacgtcgtgctcgtcgccgctgcaaacggctgccatgtccaccatagacgccgatgcc
atgccggaggatgatgcatttgccaagaccagcattggctgggtgcgcatcctgtcgcgt
tgcttccatatggccgccctgcagcccgacacgaagctggccgatctgattgccgcctat
ccggcatcctatccgggcttcctggaggcctgctgctcgctgctgaatatcatgcccatg
attccgagtctcgcacagcagcatctggagaccatactgctcaagctgggcgcctacaat
cacgagctcagtctgcagctcctgcgaacgctgctgtggcacaccacgccccaggtcttt
aagctctccagcgatgctgtgtgcgatctcatccacgaggtggtcactggctcctcgaag
catctgctggacaagctgcgcgtgctcattgactggatcatgcagctgcacgacaactac
agcaagcaggcgcgctgcaataaccctcagagcggtttcgtcaaggtcattgcctcgatc
ctgtggcgggtgcacgtccagtatcagctgccagagctgccgcatctgatcacctcggcc
ctgttcgagacctgcttcgagtgggtgtctgtcctggagcaagatgagcccctcaagagc
agcttcgattcgctgctctgtgccctgtgcttcatcaagccggagctgttcaatcagctg
ctggtcaagctgggcgtaaagctggagccgccggctcgtggccagaccgacgacagcaag
gtgcagagcggcagcgcctggttccgccgcgagggcagtgagaatctcacggtgctcctg
gaacgtcccacattcctgaagacgctggccctcgcctgccagtccccggcggctgtctac
caaatgctagactctggcctgcccaagctgctggcccacgccgtctacgagtactgcact
catctgctggcgggcttggagcaagaagctccttccctagctgcagctccggctccagct
ccagttccagctcaggcggcggtgccaactgatggccagcagggctcgtcgtccctcacg
gactttgacaaggcggaggcgcccccaagtgccagcccacccaatctcaacactccgctg
ctgagcagctcagttgtgcccaaagtgctggactttttcgccgagtgctgcgcggaggga
cccatgcggaactggctgggcacgatgcagggctctgtgttctggaagccgctgctgcag
cttctgtgccacacacactcgtcgcagttcagcaagacgctgcccatgcagcagtccttc
attcgcctggagcgctccaccatcaactttctgacgcgcgtgagtgcctgccatccggag
aaccaggaagtgctcacctccctcctcatcggcgccatcatctgcaagccgctgcgatct
gtccagggcactcgccccaccatctcgggattcacgcggcaactggtgctgcaactgctg
ctggagaacgagcacatcaccgtcgccgtgcgcagtcagaatccactgcagcgccgggac
acgctgtccgccattatgggtggcggtgggtctgggtccggctctgcggcctcgaacagc
atcagcagcaccagcctgccggtggcggcagtcaacaatcatccggccaagcgcagcagt
gcccactatatgctcttcaatgtgaccacgagcacgacctgccaggagattctcatgaat
tgcgttagcgcttatagtaacttagtttacactacatcaacagatccgcgcgctagcgag
ccctcaggcagtggcaatggaagcgggagtggcagtggtggcacgggtgccccaggagcc
gccgtaagttccaaattcgtcaatcccaaacaggacaagaactgggaccagaattgctat
atcaacctgagcaatgtggatctgagcagcctggagttcctgagcgtgggtgccgccgtg
gcggccaaggacaaacgcatcaaggatgccaaaaacctgctggccgttaacaaggacaag
gagacgcagacaaccagctcgacttccaatgtgttctatgtcgaggagtttctgttgcaa
tcgaattggtccaagaaaaatcagctggtcattgcggactatcccaacgtagtgctctct
ggtgatgccacaatctcccaggtgctggccacactagaggcggcaggccactcgctggcc
ataccgtgcctgaccctggatctggtgcccctccagcatggagacgagaccatcgacgac
aagaagacaaaggcagcctgcacagagccgctgccatcgccactgcaacgcttctcgagc
aacggtggcctctcgctgctggcccactatctgcccactgtgtatccggagcattcgggc
cgcaagaccgtgatgatggtcaccgaaaaggagaagagtcccccactgacggactgggtg
aagctggagccaaacgatgagatatacgaggatctggaggacaccatttgcgagccagtg
gccaagcagacgcccgtcagctcagtgccgcagcattcgctggccgcctttggactgttc
cttcgtttgcccgcctactccgatgtcctgctgagggacaagctgcgggcccagtgcctg
ttgcgtttggttctgggcgtgacaggcgacggcgagggcaatgacatctatagcctctcg
ctggcaccctcgctgcacacgctgccttttgaggtcttccgccagctgctggacactgtg
ccgctgtccaccgacgatggaatgctgctccgccgcgtggtcattgaggtgggggccatg
caccttgtcctcaattgtctgggcatcttttcgcatcagtcgcacaacaacaggattggg
gcaccgatcaaccagccctcgccgagtggcagtgccagcggcggtggaaacggaagcaca
accaaaacaaccacaaatggaaccgccgctggggccaagagcagtggaggggacgagccc
acgcccagtggcacctcggacgacaagagccacatgtattgggccaagggaaccggcttc
ggcactggctccaccacacagtcgtggaacgtggagcaggccctgctgcgccagaagagc
gaggaggagcatgtcaccgtgctgctgttggtgctggccagctacatcaatccgggcgac
tgtatacccagcgagatgtgcggcgaggacatactcgcctatcacgatgtgcgcgacgtg
accggggagctgcccgctctgttccagaccctgctgaagcagtcctgcttgattcccgcc
ctgagctcgtatctgcgcaacgattccgttctggacataactcgacacattccgctgtat
cgtgccatactgaagctgctgcgcgccctctcgctgtccaagtcgctcgtctcgctgctc
cagccggcgcccagcgcctgtggcgagggcaaaccacccatcgcagagctgctgacgaac
atgaagacctgcgtggacacgtatgccaagcgtctaaaagtcaacaagaagtcgaacatc
aagggccagacgcagcaattgacattcaacattgacgatggcgatgacgagggactggca
ctactcataccggacatacaggagacgagtgtgctggtgcagaagaccaccgatgccgat
gccctgatcaacatgcagagcagcagcgaggacggcagcggccagctggaacgtcccctg
agcaagtcggtcgaacagcgctatttggagctgatgaagaagcgccagttcgacacgttc
gacatgattgtcgagtcggagaacaatagctttcggtttgtggtgtcgcatcattttgag
aaaatagtgcgactggccggcgatcgctatcatccgtcgcgggttaagcggctggctcaa
gaagcggtcactctgtccaccagcctgcctctgagctacagcagctctgtatttgtgcgc
tgtgatacggacagattggatgtgatgaaggtgctcattactgggccatcggacacaccg
tatgccaatggatgcttcgagttcgatgtcttctttccgccagactatcccaatctgccc
atgatcatcaatttggagaccacgggccgccattcggtgcgtttcaatcccaatctctac
aacgatggcaaggtgtgtctgtcggtgctgaacacctggcatgggcgtcccgaggagaag
tggaatgcgcagacctccagtttcctgcaggtgctagtctccatccaatcgctgatccta
gtcccagagccgtacttcaatgagcccggctttgagcgcagtcgtggcactcctactggc
accaactcgtcgcgggagtacaatagcaacatctatcaggcctgcgttcgctgggccatg
ctcgaacagatacgcaatccgagtccctgcttcaaagacgtcatacataaacatttctgg
atgaagcgtgaggaggtctgcacacagatcgagggctggattgaggagcttagtaaggcc
cagtacacagagcgggctggccgcaccatatcgtttaactctatggttctgcgtcgacac
tatcgtcatttgcgcgaggagctggccaaattgaagccgccacacggactggaggatctg
gatgcacctttcaatcctgtttccacgctgcccccaatggatgtctccgcggcgccagtt
gccacaaccacagcaaatgtccaggtgggaacggatggtcctattgttcatgaactgaat
ctaatgacagatgatggggacgacagcgacaatggcccttgcatcctggatccagtgtcg
ggcgtcctcaaaggcgaggaggaattggttgaaattctgagtgatacagagaacgagagc
agtgtgtggcaggagaaggaagaggaggaggaggatgaaggcgacgtcgacggcgatggc
gatggcgatggcgacggtgatggcgaagaggagtaa

KEGG   Drosophila miranda: 108156367
Entry
108156367         CDS       T06132                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108156367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108156367
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dmn03036]
    108156367
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108156367
Chromosome and associated proteins [BR:dmn03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     108156367
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108156367
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 108156367
NCBI-ProteinID: XP_017143260
LinkDB
Position
2
AA seq 153 aa
MDATEATDATGAVVADKLESFRQLYLLEQHRVESFKDWPFPEQSSCSISKMAEAGFYWTG
TKRENDTATCFVCSKTLDGWESDDDPWKEHLKHAPQCEFVKLGCAEKDLTVTQFLEILGR
VVKSSIEKNCKAFKQGFIRDNENSLDEFTHKKK
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatgctacagaggcaactgatgctacgggggcagtggttgcggacaagctggagtcg
ttccggcaactatatttgttggagcaacaccgtgtggagagtttcaaggactggcccttc
cccgagcagtcgtcctgtagtatatccaagatggctgaggcgggcttctattggacgggc
acaaagcgggagaatgacacggccacatgcttcgtgtgcagcaaaaccctggatggctgg
gagtcggacgacgatccctggaaggagcatctgaagcacgccccgcaatgcgaatttgtc
aagctaggatgtgcggaaaaggatttgacggtgacacaatttctagaaatattgggccgt
gtggtcaagagcagcatagagaaaaattgtaaagccttcaagcagggctttattagggat
aacgaaaacagtctggatgagtttacgcataaaaaaaaataa

DBGET integrated database retrieval system