KEGG   Drosophila miranda: 108154884
Entry
108154884         CDS       T06132                                 

Definition
(RefSeq) beclin-1-like protein
  KO
K08334  beclin
Organism
dmn  Drosophila miranda
Pathway
dmn04136  Autophagy - other
dmn04137  Mitophagy - animal
dmn04140  Autophagy - animal
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108154884
   04136 Autophagy - other
    108154884
   04137 Mitophagy - animal
    108154884
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108154884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmn04131]
    108154884
   03029 Mitochondrial biogenesis [BR:dmn03029]
    108154884
Membrane trafficking [BR:dmn04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    108154884
Mitochondrial biogenesis [BR:dmn03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108154884
SSDB
Motif
Pfam: APG6 APG6_N DUF2147 ATG14 DUF2381
Other DBs
NCBI-GeneID: 108154884
NCBI-ProteinID: XP_017140817
LinkDB
Position
2
AA seq 422 aa
MSEAEKQAVSFACQRCLQPIVLDEQLEKISVHAMAELSLPIYRDNGNTLDTQDASSFDHF
VPPYRLTDSINGTGFMLVSDGRDNKKMSAAFNLKAELFDCLSSNSEIDHPLCEECADSML
EIMDRELRIAEDEWDVYKTYLDELEQQRQAPNVDALDKELDELKKSEQQLLSELGKLKED
EQSLNAAIAQEELEKEKLHEQEESYWREYTKHRRELMLTEDDKRSLESQISYSKQQLDKL
RDTNIFNITFHIWHAGHFGTINNFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLT
FERYRVVPFGNHSYVEVLGENRELPLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEK
RDTEFLLPYKMEKGKIIDPSTGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQFV
SQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcgaggcggagaaacaggccgtgtccttcgcctgccagcgctgtctccagcccata
gtgctggacgagcaactggagaagattagcgtccatgccatggctgaactctcgctgccc
atctacagggacaatggcaacacgctggacacacaggatgccagcagctttgaccacttt
gtgccgccgtacaggctgacagactccatcaatggaactggcttcatgctcgtttcggat
ggccgtgataacaagaagatgagtgctgccttcaatctgaaggcagagctgttcgactgc
ttgtcctccaactcggagatagaccatcccctgtgcgaggagtgtgccgactccatgctg
gagatcatggatcgagagctgcgcatagccgaagacgagtgggatgtgtacaaaacatat
ctggatgagctagagcagcagcggcaggcccccaatgtggatgccctggacaaggagctg
gacgaactgaagaagagtgaacagcagctgctgtcggagctgggtaagctaaaggaggat
gaacaatcactgaacgctgccatagcgcaagaggagttggagaaggagaagctgcacgag
caggaggagagctactggcgcgagtacaccaaacaccggcgtgagctgatgctcaccgag
gacgacaaacggagcctggagagccagatcagctactcgaagcagcagctggacaagctg
cgcgacacgaacatcttcaacatcacctttcacatctggcatgccgggcactttggcacc
atcaacaacttccgcctcggccgcctgccctccgtttccgtcgactggtcggagataaat
gccgcctgggggcagacggtgctgctcctctccgctctggcccgcaagattggcctcacc
tttgagcggtatcgcgttgttccgttcggcaatcactcgtatgtggaggtgctgggcgag
aatcgcgaactgccgctctacggaagcgggggattcaagttcttttgggataccaaattc
gatgcggccatggtggcctttcttgactgccttacccagttccagaaggaggtggagaaa
cgcgacaccgaattcctgctgccctacaaaatggaaaagggcaaaatcattgacccatct
actgggaattcctactcaataaagatacagttcaactcggaggaacagtggacgaaggcc
ttaaagttcatgcttacgaacctgaaatggggtctcgcctgggtctcctcgcaatttgtg
tcgcaatga

DBGET integrated database retrieval system