KEGG   Drosophila miranda: 108155481Help
Entry
108155481         CDS       T06132                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
dmn  Drosophila miranda
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dmn01009]
    108155481
Protein phosphatases and associated proteins [BR:dmn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     108155481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 108155481
NCBI-ProteinID: XP_017141793
LinkDB All DBs
Position
2
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESTDDRVNFRQFMNVLAHFRPLRDNKQSMLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
TKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaagtcatcactgttcctccggaacgaggagatagcgcagattcaggaggaa
actggttttactcccaaccaaatcgagagattgtactcgcgcttcacgtcgttggatcgc
aacgactgcgggaccctctcccgcgaggacctgatgcggatcccggagctggccatcaat
ccgctgtgcgagcgcatcgtccactcgttctttgccgagagcaccgacgatcgggtgaac
tttcggcagttcatgaacgtgctggcccacttccgtccgctgagggataacaagcagagc
atgctgaacagccgggaggagaagctgaagttcgccttcaagatgtacgaccttgatgac
gacggcgtgattagccgggacgagctgctctccattctgcacatgatggtgggcgccaac
atcagccaggaccagttggtcagcattgcggagcgcacaatcctggaggcagacctctgc
tgccagggcaagatatcgttcgaggacttctgcaaggccctagaccgcaccgacgtcgac
acaaagatgtccataaggtttctcaactga

DBGET integrated database retrieval system