KEGG   Drosophila miranda: 108156367
Entry
108156367         CDS       T06132                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108156367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108156367
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dmn03036]
    108156367
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108156367
Chromosome and associated proteins [BR:dmn03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     108156367
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108156367
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 108156367
NCBI-ProteinID: XP_017143260
LinkDB
Position
2
AA seq 153 aa
MDATEATDATGAVVADKLESFRQLYLLEQHRVESFKDWPFPEQSSCSISKMAEAGFYWTG
TKRENDTATCFVCSKTLDGWESDDDPWKEHLKHAPQCEFVKLGCAEKDLTVTQFLEILGR
VVKSSIEKNCKAFKQGFIRDNENSLDEFTHKKK
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatgctacagaggcaactgatgctacgggggcagtggttgcggacaagctggagtcg
ttccggcaactatatttgttggagcaacaccgtgtggagagtttcaaggactggcccttc
cccgagcagtcgtcctgtagtatatccaagatggctgaggcgggcttctattggacgggc
acaaagcgggagaatgacacggccacatgcttcgtgtgcagcaaaaccctggatggctgg
gagtcggacgacgatccctggaaggagcatctgaagcacgccccgcaatgcgaatttgtc
aagctaggatgtgcggaaaaggatttgacggtgacacaatttctagaaatattgggccgt
gtggtcaagagcagcatagagaaaaattgtaaagccttcaagcagggctttattagggat
aacgaaaacagtctggatgagtttacgcataaaaaaaaataa

DBGET integrated database retrieval system