KEGG   Drosophila miranda: 108156367
Entry
108156367         CDS       T06132                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108156367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108156367
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dmn03036]
    108156367
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108156367
Chromosome and associated proteins [BR:dmn03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     108156367
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108156367
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 108156367
NCBI-ProteinID: XP_017143260
LinkDB
Position
2
AA seq 153 aa
MDATEATDATGAVVADKLESFRQLYLLEQHRVESFKDWPFPEQSSCSISKMAEAGFYWTG
TKRENDTATCFVCSKTLDGWESDDDPWKEHLKHAPQCEFVKLGCAEKDLTVTQFLEILGR
VVKSSIEKNCKAFKQGFIRDNENSLDEFTHKKK
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatgctacagaggcaactgatgctacgggggcagtggttgcggacaagctggagtcg
ttccggcaactatatttgttggagcaacaccgtgtggagagtttcaaggactggcccttc
cccgagcagtcgtcctgtagtatatccaagatggctgaggcgggcttctattggacgggc
acaaagcgggagaatgacacggccacatgcttcgtgtgcagcaaaaccctggatggctgg
gagtcggacgacgatccctggaaggagcatctgaagcacgccccgcaatgcgaatttgtc
aagctaggatgtgcggaaaaggatttgacggtgacacaatttctagaaatattgggccgt
gtggtcaagagcagcatagagaaaaattgtaaagccttcaagcagggctttattagggat
aacgaaaacagtctggatgagtttacgcataaaaaaaaataa

KEGG   Drosophila miranda: 108159671
Entry
108159671         CDS       T06132                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108159671
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108159671
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    108159671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108159671
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    108159671
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   108159671
Ubiquitin system [BR:dmn04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108159671
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 108159671
NCBI-ProteinID: XP_017148642
LinkDB
Position
3
AA seq 493 aa
MTDLRLELESVRTATFVEWPLNAPVSAEDLVTNGFFATGNWLEAECNWCHVRIDKWEYGD
QVAERHRRCSPICSMVLAPSHCGNITLSQENDSEGNTMVDSGGTASPCACPDLHLEANRL
ETFKDWPNPNVTPQALAKAGFYYLNRLDHVKCVWCNGIIAKWEKNDNAFDEHRRFFPNCP
RVQMGPLIEFAAGKNLEELGIQPTTQPKLPNFACVDSRLRTFTDWPIGNIQPPEPLAQAG
LFYQNISDQVRCFHCNIGLRSWQKEDEPWHEHAKWSPKCQFVLLAKGPTFVREVGEAMAA
SSGSQIATAPAPQLNALMDESPAKEALALGIDGGVLRNTIQRKLSSSGSAFETLDELLHA
IFEKAGCEAALEVREPTEPTAPPLDCCQATTSKAAVSSDSMQNKAKPAVVPEASISDQMQ
RMSVAPPNGNISLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVAICPLC
RADIKGFVRTFLS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacggatcttcgactggagctggagagcgtacgcacagccacatttgtggaatggcct
ctgaatgctcccgtcagtgccgaggatttggtgacgaatggtttctttgccacggggaat
tggctggaggccgagtgcaattggtgtcatgtgcgcatcgataagtgggagtacggggat
caagtggccgaaagacatcgacgctgctccccaatttgctccatggtgctggcccccagt
cactgcggcaatatcacgctgagtcaggagaacgacagcgaaggcaacaccatggtggat
agcggcggtactgcctccccatgtgcctgtcctgatcttcacctggaagcgaatcgcttg
gagacattcaaggactggccaaatcctaacgttacgcctcaggctctggccaaggctggt
ttttactatctaaatcgcttggatcatgtcaagtgcgtatggtgtaatggcattatagcc
aagtgggagaaaaacgataacgccttcgacgagcaccgacgcttcttccccaactgtccg
cgtgtccaaatgggaccgcttatcgaatttgccgctggaaagaatctggaagagctggga
attcagcccacaacccagccaaaacttccaaacttcgcctgcgtggactcgcgactgcgc
acgttcaccgactggcccattgggaacattcagcctcccgagccactggcccaggcaggt
ctcttttatcagaatatctctgatcaggttcgctgcttccactgcaacattggtctgcgc
tcctggcagaaggaggacgagccctggcacgagcatgccaaatggtcgcccaaatgtcag
tttgtgctgctggccaagggaccaacctttgtgcgtgaggtgggtgaggctatggcggca
tcgtctggatcccagatagcaacggctccagctccccagctgaatgccctaatggacgag
agcccggccaaagaagccctcgccctgggcatagacggaggagtgttgagaaacactatt
caacgcaagctttccagttcaggctctgctttcgaaacactggatgaactgctgcatgcc
atcttcgagaaggcgggctgtgaagcagccctcgaggtgcgggagccaacagagccgact
gcaccgccccttgattgctgtcaggcaaccaccagcaaagcggcagtatcctccgattcc
atgcagaacaaggcaaagccggctgtcgtccccgaggcgagcatctcggatcagatgcag
agaatgtctgtggcaccgccaaatggcaacatttcattggaggaggagaaccgtcagctg
aaggacgcccgtctgtgtaaagtgtgtttggacgaggaggttggggtggtgttcctaccc
tgcggtcacttagcgacgtgcaatcagtgcgcccccagcgtggccatctgtcccttgtgc
cgcgccgacatcaagggatttgtgcgcacatttctatcgtaa

KEGG   Drosophila miranda: 117193609
Entry
117193609         CDS       T06132                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 2-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    117193609
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    117193609
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    117193609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    117193609
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    117193609
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   117193609
Ubiquitin system [BR:dmn04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    117193609
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 117193609
NCBI-ProteinID: XP_033254242
LinkDB
Position
Y
AA seq 493 aa
MTELRLELESVRTATFVEWPLNGPVSAEDLVTNGFFATGNWLEAECNWCHVRIDRWEYGD
QVAERHRRCSPICSMVLAPSHCGNITLSQENDSEGNTMVDSGGTASPCACPDLHLEANRL
ETFKDWPNPNVTPQALAKAGFYYLNRLDHVKCVWCNGIIAKWEKNDNAFDEHRRFFPNCP
RVQMGPLIEFAAGKNLEELGIQPTTQPKLPNFACVDSRLRTFTDWPIGNIQPPEPLAQAG
LFYQKIADQVRCFHCNIGLRSWQKEDEPWHEHAKWSPKCQFVLLAKGPTFVREVGEAMAA
SSGSQIATAPAGELNALMDESPAKEALALGIDGGVVRNTIQRKLSSSGSAFETLDELLHA
IFDEAGCETALEVREPTEPTAPPLDCCQATTSKAAVSSDSMQNKAEPAVVPEASISDQMQ
RMSVAPPNGNISLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPLC
RADIKGFVRTFLS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacggaacttcgactggagctggagagcgtacgcacagccacatttgtggaatggcct
ctgaacggccccgtcagtgccgaggatttggtgacgaatggtttctttgccacggggaat
tggctggaggccgagtgcaactggtgtcatgtgcgcatcgataggtgggagtacggggat
caagtggccgaaagacatcgacgctgctccccaatttgctccatggtgctggcccccagt
cactgcggcaatatcacgctgagtcaggagaacgacagtgaaggcaacaccatggtggat
agcggcggtactgcctccccatgtgcctgtcctgatcttcacctggaagcgaatcgcttg
gagacattcaaggactggccaaatcctaacgttacgcctcaggctctggccaaggctggt
ttttactatctaaatcgtttggatcatgtcaagtgcgtatggtgtaatggcattatagcc
aagtgggagaaaaacgataacgccttcgacgagcaccgacgcttcttccccaactgtccg
cgtgtccaaatgggaccgcttatcgaatttgccgctggaaagaatctagaagagctggga
attcagcccacaacccagccaaaacttccaaacttcgcctgcgtggactcgcgactgcgc
acgttcaccgactggcccattgggaacattcagcctcccgagccactggcccaggcaggt
ctcttttatcagaagatcgctgatcaggttcgctgcttccactgcaacattggtctgcgc
tcctggcagaaggaggacgagccctggcacgagcacgccaaatggtcgcccaaatgtcag
tttgtgctgctggccaagggaccaacctttgtgcgtgaggtgggtgaggctatggcggca
tcgtctggatcccagatagcaacggctccagctggagagctgaatgccctaatggacgag
agcccggccaaagaagccctcgccctgggcatagacggaggagtggtgagaaacactatt
caacgcaagctttccagttcaggctctgctttcgaaacactggatgaactgctgcatgcc
atcttcgacgaggcgggctgtgaaacagccctcgaggtgcgggagccaacagagccgact
gcaccgccccttgattgctgtcaggcaaccaccagcaaagcggcagtatcctccgattcc
atgcagaacaaggcagagccggctgtcgtccctgaggcgagcatctcggatcagatgcag
agaatgtctgtggcaccgccaaatggcaacatttcattagaggaggagaaccgtcagctg
aaggacgcccgtctgtgtaaagtgtgtttggacgaggaggttggggtggtgttcctaccc
tgcggtcacttagcgacgtgcaatcagtgcgcccccagcgtggccaactgtcccttgtgc
cgcgccgacatcaagggatttgtgcgcacatttctatcgtaa

KEGG   Drosophila miranda: 117193610
Entry
117193610         CDS       T06132                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 2-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    117193610
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    117193610
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    117193610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    117193610
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    117193610
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   117193610
Ubiquitin system [BR:dmn04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    117193610
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 117193610
NCBI-ProteinID: XP_033254243
LinkDB
Position
Y
AA seq 437 aa
MAVSAEDLVTNGFFATGNWLEAECNWCHVRIDRWEYGDQVAERHRRCSPICSMVLAPSHC
GNITLSQENDSEGNTMVDSGGTASPCACPDLHLEANRLETFKDWPNPNVTPQALAKAGFY
YLNRLDHVKCVWCNGIIAKWEKNDNAFDEHRRFFPNCPRVQMGPLIEFAAGKNLEELGIQ
PTTQPKLPNFACVDSRLRTFTDWPIGNIQPPEPLAQAGLFYQKIADQVRCFHCNIGLRSW
QKEDEPWHEHAKWSPKCQFVLLAKGPTFVREVGEAMAASSGSQIATAPAGELNALMDESP
AKEALALGIDGGVVRNTIQRKLSSSGSAFETLDELLHAIFDEAGCETALEVREPTEPTAP
PLDCCQATTSKAAVSSDSMQNKAEPAVVPEATISDQIQRMSVAPPNGNISLEEENRQLKD
ARLCKVCLDEEVGVVWW
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtcagtgccgaggatttggtgacgaatggtttctttgccacggggaattggctg
gaggccgagtgcaactggtgtcatgtgcgcatcgataggtgggagtacggggatcaagtg
gccgaaagacatcgacgctgctccccaatttgctccatggtgctggcccccagtcactgc
ggcaatatcacgctgagtcaggagaacgacagcgaaggcaacaccatggtggatagcggc
ggtactgcctccccatgtgcctgtcctgatcttcacctggaagcgaatcgcttggagaca
ttcaaggactggccaaatcctaacgttacgcctcaggctctggccaaggctggtttttac
tatctaaatcgtttggatcatgtcaagtgcgtatggtgtaatggcattatagccaagtgg
gagaaaaacgataacgccttcgacgagcaccgacgcttcttccccaactgtccgcgtgtc
caaatgggaccgcttatcgaatttgccgctggaaagaatctagaagagctgggaattcag
cccacaacccagccaaaacttccaaacttcgcctgcgtggactcgcgactgcgcacgttc
accgactggcccattgggaacattcagcctcccgagccactggcccaggcaggtctcttt
tatcagaagatcgctgatcaggttcgctgcttccactgcaacattggtctgcgctcctgg
cagaaggaggacgagccctggcacgagcacgccaaatggtcgcccaaatgtcagtttgtg
ctgctggccaagggaccaacctttgtgcgtgaggtgggtgaggctatggcggcttcgtct
ggatcccagatagcaacggctccagctggagagctgaatgccctaatggacgagagcccg
gccaaagaagccctcgccctgggcatagacggaggagtggtgagaaacactattcaacgc
aagctttccagttcaggctctgctttcgaaacactggatgaactgctgcatgccatcttc
gacgaggcgggctgtgaaacagccctcgaggtgcgggagccaacagagccgactgcaccg
ccccttgattgctgtcaggcaaccaccagcaaagcggcagtatcctccgattccatgcag
aacaaggcagagccggctgtcgtccccgaggcgaccatctcggatcagatacagagaatg
tctgtggcaccgccaaatggcaacatttcattagaggaggagaaccgtcagctgaaggac
gcccgtctgtgtaaagtgtgtttggacgaggaggttggggtggtgtggtggtga

KEGG   Drosophila miranda: 117193611
Entry
117193611         CDS       T06132                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 2-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dmn  Drosophila miranda
Pathway
dmn04120  Ubiquitin mediated proteolysis
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    117193611
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    117193611
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    117193611
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    117193611
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dmn04121]
    117193611
Peptidases and inhibitors [BR:dmn01002]
 Peptidase inhibitors
  Family I32: IAP family
   117193611
Ubiquitin system [BR:dmn04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    117193611
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 117193611
NCBI-ProteinID: XP_033254244
LinkDB
Position
Y
AA seq 437 aa
MAVSAEDLVTNGFFATGNWLEAECNWCHVRIDRWEYGDQVAERHRRCSPICSMVLAPSHC
GNITLSQENDSEGNTMVDSGGTASPCACPDLHLEANRLETFKDWPNPNVTPQALAKAGFY
YLNRLDHVKCVWCNGIIAKWEKNDNAFDEHRRFFPNCPRVQMGPLIEFAAGKNLEELGIQ
PTTQPKLPNFACVDSRLRTFTDWPIGNIQPPEPLAQAGLFYQKIADQVRCFHCNIGLRSW
QKEDEPWHEHAKWSPKCQFVLLAKGPTFVREVGEAMAASSGSQIATAPAGELNALMDESP
AKEALALGIDGGVVRNTIQRKLSSSGSAFETLDELLHAIFDEAGCETALEVREPTEPTAP
PLDCCQATTSKAAVSSDSMQNKAEPAVVPEATISDQIQRMSVAPPNGNISLEEENRQLKD
ARLCKVCLDEEVGGEWW
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtcagtgccgaggatttggtgacgaatggtttctttgccacggggaattggctg
gaggccgagtgcaactggtgtcatgtgcgcatcgataggtgggagtacggggatcaagtg
gccgaaagacatcgacgctgctccccaatttgctccatggtgctggcccccagtcactgc
ggcaatatcacgctgagtcaggagaacgacagcgaaggcaacaccatggtggatagcggc
ggtactgcctccccatgtgcctgtcctgatcttcacctggaagcgaatcgcttggagaca
ttcaaggactggccaaatcctaacgttacgcctcaggctctggccaaggctggtttttac
tatctaaatcgtttggatcatgtcaagtgcgtatggtgtaatggcattatagccaagtgg
gagaaaaacgataacgccttcgacgagcaccgacgcttcttccccaactgtccgcgtgtc
caaatgggaccgcttatcgaatttgccgctggaaagaatctagaagagctgggaattcag
cccacaacccagccaaaacttccaaacttcgcctgcgtggactcgcgactgcgcacgttc
accgactggcccattgggaacattcagcctcccgagccactggcccaggcaggtctcttt
tatcagaagatcgctgatcaggttcgctgcttccactgcaacattggtctgcgctcctgg
cagaaggaggacgagccctggcacgagcacgccaaatggtcgcccaaatgtcagtttgtg
ctgctggccaagggaccaacctttgtgcgtgaggtgggtgaggctatggcggcttcgtct
ggatcccagatagcaacggctccagctggagagctgaatgccctaatggacgagagcccg
gccaaagaagccctcgccctgggcatagacggaggagtggtgagaaacactattcaacgc
aagctttccagttcaggctctgctttcgaaacactggatgaactgctgcatgccatcttc
gacgaggcgggctgtgaaacagccctcgaggtgcgggagccaacagagccgactgcaccg
ccccttgattgctgtcaggcaaccaccagcaaagcggcagtatcctccgattccatgcag
aacaaggcagagccggctgtcgtccccgaggcgaccatctcggatcagatacagagaatg
tctgtggcaccgccaaatggcaacatttcattagaggaggagaaccgtcagctgaaggac
gcccgtctgtgtaaagtgtgtttggacgaggaggttgggggggagtggtggtga

DBGET integrated database retrieval system