KEGG   Drosophila miranda: 108156639
Entry
108156639         CDS       T06132                                 

Definition
(RefSeq) caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108156639
   04215 Apoptosis - multiple species
    108156639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108156639
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     108156639
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108156639
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-GeneID: 108156639
NCBI-ProteinID: XP_017143726
LinkDB
Position
2
AA seq 348 aa
MENTMADPNTNNSSSNESTDQVGIRVENENPDDHTDAFGSVGGSSGTAAASSSSHHNNIY
GSGAIGQLANGYKSPSSSYGKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKS
RAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDIVRTIELAASQNHGDSDCILVAILSHGE
MGYIYAKDTQYKLENIWSFFTANHCPSLAGKPKLFFIQACQGDRLDTGVTMQRGHTETDG
DSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFV
SQRVAVDFESCTPDTPEMHQQKQIPCVTTMLTRILRFSDKQLVPAGRV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaaaatacaatggccgacccaaacacaaacaatagcagcagcaacgagtccaccgat
caggtaggaattcgcgtggaaaacgaaaacccggacgatcacacagacgcctttggatct
gtgggtggcagcagtggcacagctgcagcctcgagttcctcgcatcacaacaacatctac
ggtagcggagccattggtcagctggccaatggctataaatccccctcttcgagttatggc
aaaaatgttgcaaaaatggtcacggaccgtcatgccgcagagtacaatatgcgacacaaa
aatcgtggcatggctttgatcttcaaccatgagcacttcgaggtgcccactttgaagtcg
cgtgcaggcaccaatgtggactgtgagaatctgacccgagtgctgaaacagctcgatttt
gaagtgaccgtctataaggactgtcgctacaaagacattgtacgtacaattgaattggcg
gcctcgcagaatcacggcgatagcgactgcattttggtggcgattctatcgcacggagag
atgggctacatctatgccaaagacacccaatacaagctagagaacatctggagcttcttc
acggccaatcactgcccctcgctggctggcaagccgaagctgttcttcattcaggcctgc
caaggcgaccgattggacacgggagtgacaatgcaacgaggacataccgaaaccgatggc
gactcatccatgagctacaagatacccgtacatgcagatttcctcattgcctactcgacc
gtccccggcttttactcgtggcgcaacaccactcggggaagctggtttatgcagagcctg
tgcgccgagctggctgccaatggcaagcgcctggacatactaacgctgctgaccttcgtc
tcgcagcgtgtggccgttgactttgagtcatgcacccccgatacacccgagatgcaccag
cagaagcagatcccctgcgttaccacgatgctaacgcgcattttgcgtttcagcgataag
caattggtccccgccggacgagtttga

KEGG   Drosophila miranda: 108157734
Entry
108157734         CDS       T06132                                 

Definition
(RefSeq) caspase-3
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108157734
   04215 Apoptosis - multiple species
    108157734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108157734
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     108157734
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108157734
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108157734
NCBI-ProteinID: XP_017145399
LinkDB
Position
2
AA seq 308 aa
MDDTDFSLFGQKNKHKKDKADATQIAKTPTSEADLKRIIISRPTVDDTYENCQRAGIAVI
LNHKDVKGQKQRVGTERDRDDMQHTLQTFGFDVRTYNDLTFSDINDMLKEVAREDHSDND
CFVLVVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGENLEKAV
EFTSFAVMTRSLAPAEAAPVQPITYAIPSTADMLVFYSTFDKFFSFRNVDDGSWFIQSLC
RVLDMAAFNEAGQPDGVDLLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTF
QLRVKPKT
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgacacggacttttcgctcttcggccagaagaacaagcacaagaaagacaaagcg
gatgccacacagatcgccaagacgcccacatcggaggcggatctgaagcgcatcatcatc
tccaggcccaccgtcgatgacacctacgagaactgtcaacgcgccggcatcgcggtgata
ctcaatcacaaggacgtcaaggggcagaagcagcgcgtgggcaccgaacgggatcgcgat
gacatgcagcacaccctgcagacctttggcttcgatgtgaggacctacaacgatctgacc
ttctccgatatcaacgatatgctcaaagaggtggcacgcgaggatcatagcgataatgat
tgcttcgttctcgttgtcatgtcccatggcactgagggcaaggtctatgccaaggacatg
tcctatccggtggagcggctgtggaaccccttcctgggcgacaactgcaagaccctgaag
aacaagccgaagctcttcttcatacaggcctgccgtggcgagaatctggagaaggcagtg
gagttcacctccttcgcggtgatgaccagatctctggcccccgccgaagcggcgccggtc
caaccgattacgtatgccatacccagcacggcggacatgctcgtcttttactccaccttc
gacaaatttttctcatttcgcaatgtggacgatggctcgtggtttattcagagtctgtgc
cgagtcctggacatggccgcctttaacgaggctggccaacccgacggcgtcgatctgctg
cgcctgctgaccgccgtcaacaggaaggtggcctacgagtaccagtcgaatacgaagaac
gaggccctcaaccaaatgaaggaaatgcccaactttatgtccacactcaccaaaactttc
caattgcgtgtgaagccaaagacctga

DBGET integrated database retrieval system