KEGG   Drosophila miranda: 108157076Help
Entry
108157076         CDS       T06132                                 

Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
dmn  Drosophila miranda
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108157076
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmn04147]
    108157076
   04090 CD molecules [BR:dmn04090]
    108157076
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     108157076
Peptidases and inhibitors [BR:dmn01002]
 Metallo peptidases
  Family M1
   108157076
Exosome [BR:dmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108157076
CD molecules [BR:dmn04090]
 Proteins
  108157076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Reprolysin_3
Motif
Other DBs
NCBI-GeneID: 108157076
NCBI-ProteinID: XP_017144401
LinkDB All DBs
Position
2
AA seq 945 aa AA seqDB search
MFLSRNWMQVVLAWAVAAFATATVVVAVQNAKLEADLRDVQEKIDIYKELDVRPTLQRER
RDDIIDYRLPTALLPKHYELYWHPDLDTGTFTGQEKITIDVVEATNQIILHSYLLDVTNV
YVLNREVVEYVLEVERQLLIITLTEDLVVDSSITLGILFNGNMTDKLVGLYSSTYKSEAG
DQRNISSTQFEPVYARQAFPCFDEPAMKATFAITVVHPTGSYHAVSNMKLSESNYLGEYT
EAIFESTVSMSTYLVCIIVSDFASKSTTVNANGIGEDFSMEAFATPHQLNKVDFALEFGA
AVTEYYIQYYNVPYPLTKLDMAAIPDFSSNAMEHWGLVTYRETALLYDESYSSTSNKQSI
ASVLAHEIAHQWFGNLVTMKWWNDIWLNEGFARYMQYKGVNAVYPDWGMLEQFQIIALHP
VMVYDAKLSSHPIVQEVESPAEISAIFDTISYEKGGSVIRMLENLVGSEKFEEAVTNYLV
KYQFENTVTDDFLSEVDLVTDFDVKLLMRTWTEQMGYPVLNVSRGDAGFLITQQRFLSNK
ASYEEAPEDSEFQYRWSVPVTYTIDAWEDDNVESFVFPYDNDTAEIALDVDVQWIKLNVH
QLGYYRVNYEDSLWDALIKQLIADPARFDVADRSHLLNDAFAVADASQLSYKVPLEMTAY
LGQERDFAPWYVAAEKLKALQRSLMFNEGYVSYLTYARTLVDSVYQEVGWSVDANNHLNN
RLRVSILSAACSLGLPDCLDQAAQSFNTWLQNPTAANRPAPDLREIVYYYGMQQSTSNSD
WDKLFELFLEETDASEKLKLMYGLAGVQDAQLLFNFLVLASDESIVRSQDYFTCVQNIAG
NPVGEPVVWDYYREQWPQLSARFGLTNRNFGRLIAQITKSFASQVKLEELQQFYAKYPES
GAGANSRLEAVETIKYNIEWLKQNSGDISDWLSGTSVPLTKENRL
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgtcgcgaaattggatgcaggtggtcctggcctgggcggtggcggcttttgcc
acggccactgtagtggttgcggtgcagaacgcgaaactggaggcggatctgcgcgatgta
caggaaaagattgacatctacaaggagctagatgtgcgtccaaccctccagcgagagaga
cgcgacgatattattgactatcgtctgcccactgcactgttgcccaaacactacgaactc
tactggcatccggacctagatactggcaccttcaccggccaggagaagatcaccatagat
gtcgtggaggccacgaatcaaatcattttgcactcttacctgttggatgtgacgaatgtt
tatgtgctgaaccgagaggtagtggaatatgttttggaggtggaacgacagctcctgatc
ataacgttgacggaggatctggtggtggattccagcatcaccttgggtattctctttaac
ggaaatatgacggacaagctggtgggtctttacagcagcacctacaagtcggaagcggga
gaccaacgaaacatttcgtcaacgcaattcgagccagtctatgcccgccaggccttcccg
tgcttcgatgagccggcgatgaaggctactttcgccatcacagtggtacatcccacagga
tcttaccacgcagtctccaatatgaagctatccgaatccaattatttgggcgaatacacg
gaggccatcttcgagagcactgtatcgatgagcacgtacctggtgtgcatcattgtttcc
gattttgcctccaagtccacaactgttaatgccaatgggattggcgaggacttctctatg
gaggcttttgccactccccaccagctgaacaaggttgactttgctttagagtttggagct
gccgtcacggagtactacatccagtattacaatgtgccgtatccactgaccaaactggat
atggctgccatccccgacttctcctccaatgccatggagcactggggtctggtcacttac
cgcgagacggctctactctacgacgagagctacagctcgacatccaacaagcagtctatc
gcctccgtcctggcccacgagattgctcaccaatggttcggcaatctagttaccatgaaa
tggtggaatgacatctggctaaacgagggatttgcccgctacatgcagtacaagggagtg
aacgcagtgtatccagactggggaatgctggagcaattccaaataatcgccctgcatcct
gtcatggtctatgatgccaaactctcttcgcaccccattgtccaggaagtggagtcaccg
gctgagatcagcgccattttcgacaccatcagctatgagaagggtggctcggtcatccgg
atgcttgagaaccttgtaggttccgaaaaattcgaggaggctgttaccaactatttggta
aagtatcagtttgaaaacacggtcacggatgacttcctgagcgaggtggaccttgtgaca
gactttgatgtgaagctcttgatgcgcacatggaccgaacagatgggctacccggtcctg
aatgtgtcccgtggggatgctggattcctcattactcagcagcgcttcctctccaacaag
gccagctatgaggaggctcccgaagacagcgaattccagtacaggtggagcgtgcccgtc
acttacaccatcgacgcttgggaggacgacaacgtcgagagcttcgtgttcccttacgat
aatgacacggcggaaatcgccttggacgttgatgtccagtggattaagctgaacgtccat
caattggggtattatcgcgttaactacgaagatagtctctgggatgccctcatcaagcaa
ttgatagccgatcccgcccgattcgacgttgccgatcgctcccatcttttgaatgatgcc
ttcgccgtggccgatgccagccaactgtcctacaaagttccgctggagatgaccgcctac
cttggccaggagcgtgactttgcgccctggtacgtggcggctgagaagcttaaggcgctg
caacgcagcctgatgttcaacgagggctacgtttcctacttgacctatgcaaggactctg
gttgacagcgtctaccaggaagtgggctggagtgtggacgcgaataaccacttgaataat
cgactgcgggtgtccatcctgtccgcggcctgttccctcggcctgcccgactgtctggac
caggcagctcagagcttcaacacctggcttcagaaccccaccgccgccaaccgaccagcg
cccgatctgcgcgagatcgtctattattacggcatgcagcagtcgactagcaactccgac
tgggataagctatttgaacttttcttggaggaaacggatgccagcgagaagctgaagctt
atgtatgggttggctggtgttcaggacgcccagttgctgttcaacttcctcgtactggcc
agtgacgagagtattgtgcgctcccaggactattttacctgcgtgcagaacattgctggc
aaccccgtgggcgagcccgtggtgtgggactactaccgagagcaatggccccagctgagt
gctcgtttcgggctgacaaatcgaaactttggcaggctgattgcccagatcacgaagagc
tttgccagccaggtcaagctggaggaactgcagcagttctatgccaagtacccagagtcc
ggggccggggccaactccaggctggaggcggtggagaccatcaagtacaacatcgagtgg
ctgaagcagaacagcggtgacataagcgactggctaagtggcacctccgttccgttgacc
aaggaaaaccgattgtaa

DBGET integrated database retrieval system