KEGG   Drosophila miranda: 108157255
Entry
108157255         CDS       T06132                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108157255
   04215 Apoptosis - multiple species
    108157255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108157255
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dmn03110]
    108157255
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     108157255
Peptidases and inhibitors [BR:dmn01002]
 Serine peptidases
  Family S1: chymotrypsin family
   108157255
Chaperones and folding catalysts [BR:dmn03110]
 Other chaperones and cochaperones
  DegP / HtrA
   108157255
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 Peptidase_S46 PDZ Tricorn_PDZ Hjc
Other DBs
NCBI-GeneID: 108157255
NCBI-ProteinID: XP_017144722
LinkDB
Position
2
AA seq 427 aa
MALRCINNLEIFLRRCTAPTLHRCCVASSRTAHTASSSKGSGGDNSKDKENNGQNKSGYR
RFGWRSVFQFCVPFSMGALVSAVLIEGHRDELTPTISARSLKGRRNEFNFIADVVAGCGD
SVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPHTMVQVRLSDGR
TFPATIEDVDQTSDLATLRIHVSGLPVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVI
SATQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPI
DYVKVFLERAAERRKKGSAHKTGYPVKRYMGITMLTLTPDILFELKSRTQNMPNNLMHGV
LVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALAEGRKDLEIVILRGVKQMHV
KITPEDP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgctgcgatgtataaacaatctggaaatattcttgaggcggtgcactgcacccacg
ttacaccgctgctgtgtggccagcagcagaacagctcacacggccagcagcagcaaaggc
agcggcggcgacaatagcaaagacaaagagaataatggccagaataagtccgggtacagg
aggtttggctggcgcagtgtttttcagttctgtgttcccttctccatgggtgctctggtc
agtgccgtgctgatagaaggacatagggacgaactcacaccaacgatctcagcgcgttcg
ctgaaaggacggcgaaatgaattcaacttcatcgctgacgtggtggccggctgtggagac
tccgtggtgtacattgagattaaggacactcgccacttcgactacttcagtggtcagccc
ataacagcgtccaacggatcggggttcgtgatcgagcagaacggtctcattctgaccaat
gcccatgtggttatcaacaagccgcacacgatggtgcaggtgcggctgtcggacggacgc
acctttcccgccacaatcgaggacgtggaccagacctctgacctcgccacgctgcgcatt
catgtcagcggcctgcccgtgatgaagctcggcaaaagcagcaccctgcggtccggcgag
tgggtcgtggccctgggcagccccctggcgctgagcaacacggttactgctggcgtcata
agtgccacgcagcgtgcctcccaggagctggggctgcgcaaccgcgatatcaactacctg
cagacggacgcggccattacctttggcaactctggggggccgctggtgaatctggatggc
gaggccattggcgtcaactcaatgaaggtcaccgctggcatcagctttgccatacccatc
gactatgtaaaggtgttcctcgagcgggccgcggagcgtcgcaaaaagggatctgcccac
aaaacgggatatccggtcaagcgatacatgggcatcaccatgctgaccctcacgcctgac
atactgttcgagctgaagtcccgcactcagaacatgcccaacaatctgatgcacggcgtg
ctggtctggaaggtcattgtgggctcaccggcacacagtggcggtctgcaaccaggcgac
attgtcacccacattaacaaaaaggagatcaagaactcctcggacgtgtatgatgccctg
gccgaaggcagaaaagacctggaaatcgtcatcttgagaggtgttaagcaaatgcatgtg
aaaatcacaccagaggatccctag

DBGET integrated database retrieval system