KEGG   Drosophila miranda: 108157384
Entry
108157384         CDS       T06132                                 

Definition
(RefSeq) fas-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
dmn04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108157384
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    108157384
SSDB
Motif
Pfam: Death DED
Other DBs
NCBI-GeneID: 108157384
NCBI-ProteinID: XP_017144904
LinkDB
Position
2
AA seq 241 aa
MTGNHWYDILKKIACEGSSDIDELKGIFETELSKRKFDSIRNIEDLIDVLERADKLSLDN
VEPLRKMSSHEPKLIEALDRYGTLVSAPREPINIYQEERLAEELRQHLRISQVFQIGSAP
GVAPPAFTPAAAPTPPPPQQNYVTPAAFTDRKRTAVFNKISEELGRFWRTFGRKAGIGEG
TMDDIEERYPRDLKSRILHLLKLIEEDDCHDPRQFLMRLCRALTECGRNDIKRKVEQIMS
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atgactggaaatcattggtacgatatactaaagaaaatagcctgtgaaggctcttcggac
attgacgagctgaaggggatctttgaaacggaactttcaaagagaaaattcgactcgatt
cggaatattgaagatctaattgatgttctggaacgtgcggataagttgagcctggataat
gtcgagcccctccgcaagatgtcctcccatgaaccgaaactgattgaagccctggacagg
tacgggaccctcgtgtcggctcctcgggaacccatcaatatctatcaagaagaacgactg
gctgaggagctgcggcaacacctacgcattagccaggttttccaaatagggtcggctcca
ggggtagcacctccagcattcacccctgctgctgcacctacgccgccaccgccacagcag
aactacgtgacaccagctgcatttacggatcgcaaacgcacggctgtttttaataagata
tctgaggaactgggacgattctggcgaacatttggacggaaggcgggcattggtgagggc
accatggacgacatcgaagaacgatatccccgtgatctcaaatctagaattttacatctg
ctgaagttgattgaggaggacgactgccatgacccaagacaattcctgatgcgtctctgc
cgagccctgacggaatgtggtcggaacgacataaaaaggaaggtggagcaaataatgtcc
cactaa

DBGET integrated database retrieval system