KEGG   Drosophila miranda: 108158700
Entry
108158700         CDS       T06132                                 

Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108158700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108158700
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     108158700
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108158700
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108158700
NCBI-ProteinID: XP_017146724
LinkDB
Position
3
AA seq 254 aa
MAFPRPPKFGERRMMLRRQLSPETLSEASGELKPTPTISAPRLIYIFNHETFKNDLHEPR
AGSEKDVQALRKTFEKLQCQIIEIKDPTLAAVKEKISEIERKNFEQQSALIIVLLSHGGE
NEMIVASDNKEYSLHKDVLLPLFKNETLKGKPKILIAQACKGELEADATLMKHSPNEYVK
CFSSTEGFKSYRRASEGSLYIQTLCKCMDELAIEKDFLSIMDEVNLKVDKDSSAKGYRQL
PCYTKAISKKYYFR
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccttccccagaccacccaaatttggcgaacgccgcatgatgttacgtagacagctg
tcaccagaaacgctgtcggaagcaagtggagagctcaaacccacgcccacgatatcagct
ccccggctcatttacatattcaatcatgagacttttaaaaacgatcttcatgaaccacga
gctggcagcgagaaggatgtacaagcgctgcgcaagacattcgagaaactccagtgccag
ataatagaaataaaggatcctacattggctgcggtaaaggagaaaataagtgaaatcgaa
cgaaaaaactttgagcagcagtctgcattgattattgtattactgagccacggaggtgaa
aacgaaatgatcgtggcatcagacaacaaggagtactcactgcacaaggacgttctcttg
ccactatttaaaaacgagactctcaaaggaaagcccaagatccttattgcgcaggcatgc
aagggcgaattggaagcggatgcaactctaatgaaacatagtcccaacgagtacgtcaag
tgctttagtagcaccgagggctttaagagctatcgcagggcgtccgaagggtccctatac
atccaaactctgtgcaagtgcatggatgagcttgcgattgagaaggactttttatccatc
atggacgaagtgaacttgaaggtcgacaaagactccagtgcaaagggataccggcagtta
ccttgttataccaaagcgataagtaaaaagtattactttaggtag

DBGET integrated database retrieval system