KEGG   Drosophila miranda: 108159879
Entry
108159879         CDS       T06132                                 

Definition
(RefSeq) uncharacterized protein LOC108159879
  KO
K02084  apoptotic protease-activating factor
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108159879
   04215 Apoptosis - multiple species
    108159879
SSDB
Motif
Pfam: NB-ARC APAF1_C Hira
Other DBs
NCBI-GeneID: 108159879
NCBI-ProteinID: XP_017148980
LinkDB
Position
3
AA seq 1490 aa
MDTDVNQMHYHYKDILSVFLDPFIEDFDCKDVEDSLRSILTKREIDFIFASDQTDVRIYL
LFWKLLEKPESIVKRFVEEVLNYRDGANYEFLMTPIKAEYLQPSPNTRLYVEQRDRLFND
NQVFSKYNVPRLKPFLDLTKALLELRPAKNVLVDGPLGAGKQWLVLDVCSSYKVQQKMDF
KIFWLNVKNCNSPEADLEMLLTLLYQIDPSWSSRCDSGTWNIMQRIDSVKIELRRLLKSK
PYENCLLVLRNVQSVRTWKAFNLGCKILLTTRYKCVTDYLSAATTKHVPLKDALTEHEAE
SLIVKYLHCRPEDLPREVLTTNPRSLSIIAESIRDGLATWENWKDVNCNKLTSIIESSLK
VLEPVINRNMFDKLFIFPPSAHIPIDLLSLVWSDDKSDSDDPMVVVNKLHRYSLVEKQAH
PSTISIPTIYLELKLRVDNAAALHRKIVDHYNITKAFDDDDDLTVPFLDGYFYCHIGHHL
TNLEHSESVALFRKIFLDFRFLEQKIRYDKTAWNASGSILNTLQQLKFYSSYIIDNDPKF
KRLVNALLDFLPKIEENLIRSKFTRLLRIALMDEEEAIYEEAHRQVQRFGDQVWFTEHGR
FHQHRQIINLGENTVRHVLYLNNDFCLMALDSKQMLLTDVSLEAEDTYLLKDDNDSSDIL
KMAVFNNQKHLLTLHSNGSVKLWSLWAECFGRRHSSGSRQRVRPPHLSHLRKYAATRTYK
QLVNGVAKRAMSYQSADQNIAAFYLNEEATVGDAKIQLHVAFSNGDVCICEWDDRDQVFK
SSNTPTLETHPLRVRCFVQVLNRYYVICTADCTLTVWDLHNGSCDKPELSGYDVHNDPPL
AIEVYNERSQHSTLLLIHRYSVWRLTFEPGDFQQPLVRLKSEPVQLPDMSFITCAKGSPD
GRYLILGTSVGLIVYDIQLSSPVLRSNVSEHIECVDIYELCDPIYKYIVLCGAKGKRLLH
VHTLRRVDSGITWVHNVDETKGMTRACLEPNVYLRPLLDMTRKRSQLLAIDSKERIHQIE
TTADPSARRRSSISSWSTITPTHAASKTRITAISAHDDDHIFVGYMDGVIIDVNRDAVLP
QQYITEPIDYLKQVNSQLLVASAHGPRKTVIFQLQPELPSLPVAGAAPVDWPLKLELDTK
YSCLLGGKFLLLFSEHGVFQLDISNPLVLIKLENCDEPLMGFDLKNGLLFLAFGNNTIEV
SRFSFTDTGLRNDVICRKRITEEQKISYLIAADDASLFALGFQNGIIELYSLAGSAIQLV
YSIKEVHEQCITQLRFSPCKLLLISCGEQLCFWNVTHMRNNQIESQLAIRRSRRHRMHSV
TQEDAVDAAPIVSDMSEPPPFVSHLHQPVRDTQPEVDLWRNKRGNAIRPELLACIKFVGN
KASQFFTDAKFSQFYSIDDEGVYYHLQLLETNPHMPPSGSSMHLQMAERLASEMISDMQY
ANLADIRIIDPPLTIGGIDDEGADVVGDLQPESSATSQAETPLVVDECSS
NT seq 4473 nt   +upstreamnt  +downstreamnt
atggacactgatgtgaatcagatgcattaccattataaggatatattgtcggtgtttttg
gaccccttcattgaggactttgactgcaaggatgtggaggactcactgcgttcgatacta
accaaaagggaaatcgatttcatttttgcatcggatcaaacggatgttagaatctacctt
ttgttttggaaattgctcgagaagccagagagcatcgttaaaagattcgtcgaggaggtt
ctcaactatcgcgatggggccaactacgaattcctgatgacgcccatcaaagccgagtac
ctacagccgagccccaacaccaggctgtacgtagagcagcgggatcgtctcttcaatgac
aatcaagtgttttccaagtacaatgtgccgcgcctaaaaccgttcctcgacttaaccaag
gccctgctggagttgaggccagccaagaatgtcctggtcgatggccccctgggcgccggc
aagcaatggcttgtgctcgacgtttgctcctcgtacaaagtgcagcagaagatggacttt
aagatattctggctgaatgtgaagaactgcaacagccccgaggcagacctcgaaatgctg
ctcactctgctctaccagatcgatccgagctggagcagccgatgcgactccggcacctgg
aacatcatgcagcgcattgacagcgtcaaaatcgaactgcggcgcctgctcaagagcaag
ccatacgagaactgcctgctggtgctgcgaaatgtgcagagcgttcgcacctggaaggcg
ttcaatctcggctgcaagatactcctgaccactcgctacaagtgcgttaccgattacctg
tccgcggcgaccaccaagcatgtgccgctgaaggatgccctcaccgagcacgaggctgag
tcgctaattgtcaagtatctccactgcaggccagaggatctgcccagggaagtgctgacg
acaaatccacgcagcctgagcattattgccgagagtatacgcgacggtctggccacttgg
gagaattggaaagatgtgaactgcaataaactcacgagcattatcgagagctcactgaag
gtgctggagccggttataaataggaatatgttcgataagctcttcatattccctccgtcc
gcccacatacccatcgatctcctatctctggtttggtcagacgataaatcagatagcgac
gatccgatggtggtggtgaataaactgcaccggtactccttggtggaaaagcaggcccat
ccgtcgaccataagtatacccacgatatacttggagttgaaactaagggtggacaacgct
gctgcactccacagaaaaatcgttgatcattacaacatcacaaaggctttcgacgatgat
gacgatctgacagtgcccttcttggatggctatttctattgccatatcggccaccatctg
accaatttggagcactccgagagcgtggctctgttccgcaagattttcctcgattttcgg
tttcttgaacaaaagatacgatacgacaagacagcgtggaatgccagcggatcgatactc
aacactttacagcagctgaaattctacagctcctacattatcgacaatgatcccaagttt
aagcgcctggtgaatgctttgctggatttccttccaaagattgaggagaaccttatacgg
tccaagtttacccgccttctgcgaatcgctctgatggacgaggaggaggccatatacgag
gaggcccaccgacaagtgcagcggttcggtgatcaagtttggttcacagagcatggtcgc
tttcaccagcatcggcaaattatcaacctcggggagaatacggttcgacacgtcctgtac
ctgaacaatgacttctgcttgatggctctggacagcaaacaaatgctgctgaccgacgtt
tctctggaggcggaggacacgtatctgctgaaggatgacaacgacagcagcgacatcctg
aaaatggccgtgtttaataaccagaagcacctgctcacgctccacagcaatggcagtgta
aagctctggtcgctgtgggccgagtgctttgggcggcgtcacagcagcggaagtcgccag
cgtgtgcgaccgccacacctttcccatttgcggaaatatgcggcgactcgtacgtacaag
cagctggtcaatggcgtcgccaagcgcgcaatgagctaccagagcgcggaccagaacatt
gcggcgttctacttgaacgaggaagcaaccgttggagacgcaaagattcagctgcatgtg
gccttcagcaacggcgacgtttgcatctgtgagtgggatgacagggaccaagtgttcaag
tcctccaacacgcccaccctcgagacgcatccgcttcgtgtgcggtgtttcgttcaggtg
ctgaaccgctactatgtcatatgcaccgctgactgcaccctcaccgtttgggatctgcac
aacggttcttgcgacaagccagagctcagtggctacgatgtccacaatgacccaccgctt
gcgattgaagtctacaatgaacgcagccagcattcgaccctgctgctcatccacaggtac
agcgtgtggcggctgacgttcgagcctggcgactttcaacagcctctagtgcggctcaag
tcggagcctgtgcagctgccggacatgagcttcattacctgcgctaagggatcgccagat
ggtcggtatctgatcctgggaacatcggttggcctcattgtgtatgacatccagctgtcc
agtcccgtgctgcgcagcaatgtgagcgagcacatcgaatgcgtggacatctacgagctg
tgcgatcctatttacaagtacatagtgctttgtggtgccaaaggaaagcggctcctgcac
gtgcacacactgcgaagggtggattcgggtattacgtgggtccacaatgtggatgagaca
aagggcatgacacgggcttgcctcgagcccaatgtctatctgcgcccgctcctggacatg
accagaaagcggtctcaactgctggccatcgactccaaggagcgtatccatcagattgag
accaccgccgacccaagtgctcgccgcaggtccagtatttcgtcctggtcaacgataacc
cccacgcatgcggccagcaagacgcgcataaccgcaatatccgcccacgacgacgatcac
atatttgtcggctacatggacggggtgatcatcgatgtgaaccgcgatgcggtgctgcca
caacagtatattacggagcccatcgactacctcaagcaggtcaactctcagctgctggtg
gcgtcggcgcacggtccacgcaaaactgtgatattccagctacaaccagagctgccatcg
ctgccagtggctggagcagcgccagtggattggccgctcaagttggagctggacaccaaa
tattcctgccttctgggtggaaagtttctgctcttgttctccgagcacggagtctttcaa
ctggatatatccaaccctctggtactcatcaaactggaaaactgtgacgaaccacttatg
ggcttcgacctgaagaacggtctcctctttctggccttcgggaacaacaccattgaggtc
tcccgattcagcttcaccgacacggggctaaggaacgatgtcatctgcaggaaacgtatc
acagaggagcagaaaataagttacctgattgccgcagatgacgcttccctgtttgcactg
ggcttccagaatggcattatcgagctctactctctggcaggatctgccattcagttggtc
tacagcataaaggaagtgcacgagcagtgcatcacacagctacggttctcgccgtgcaaa
ctgttgctcattagctgcggggagcagctgtgcttctggaacgtgacccacatgcggaac
aaccagatcgagtcgcagctggccataagacgcagccgccggcacaggatgcacagtgtc
acgcaggaggatgctgtcgatgcggctcccattgtttcggacatgtcagagccaccgcca
tttgttagccatctccatcaacccgttcgcgacacccagccggaagtagatctgtggcgg
aacaaacggggcaatgccatacggccggagctgctggcttgcatcaagtttgtgggtaac
aaggccagccagttcttcaccgacgccaagttctcgcagttctattcgatagacgacgag
ggcgtctactatcatttgcaacttctggaaacaaatccccacatgccgccgagtgggtcg
tcgatgcatctgcagatggctgaacggctcgcaagcgagatgatcagtgacatgcagtat
gcgaatctggcggacattcgaataattgaccccccattgacaattgggggcattgatgac
gagggagccgatgtcgttggggatttgcagccggagtctagcgcaacgagccaggcagag
acgccgctggttgtcgacgaatgcagctcatga

DBGET integrated database retrieval system