KEGG   Drosophila miranda: 108159904
Entry
108159904         CDS       T06132                                 

Definition
(RefSeq) caspase-1-like isoform X1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108159904
   04215 Apoptosis - multiple species
    108159904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    108159904
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     108159904
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   108159904
SSDB
Motif
Pfam: Peptidase_C14 B5 DUF5122
Other DBs
NCBI-GeneID: 108159904
NCBI-ProteinID: XP_033251488
LinkDB
Position
Y
AA seq 290 aa
MTDEFINRSFITGDSTDVAGGATVGSGSTRNRVARYAREYNMNHKNRGLALIFNHEFFKI
PTLQTRLGTNVDAEELSKTFKKLGFDVTVHKDCKWQKIRENVEKAAAQDQTDNDCLAIAI
LSHGEHGCIYANDIQYKLDLILHYFTAKMCPTLAGKPKLFFIQACQGYLVDGGMMWNKCR
TETDGDSSMSYKIPVHADFLISYSTIPGYTSWRNIDNGSWYIQSLIEELNSNGKTDDLLT
MLTFVSQRVAIDFESNMPDNPIKDGQKQIPCFTSMLTRMLHFGYKPNRTE
NT seq 873 nt   +upstreamnt  +downstreamnt
atgacggacgagttcataaacaggagctttattactggcgattcaacggacgtagctggt
ggtgcaacggttggatcgggtagtacccgaaatcgtgtggcgcgctatgccagggagtac
aacatgaatcataagaatcggggattggccctaatattcaatcatgagtttttcaagata
cccacgctgcagactcgcttgggcaccaacgtggacgcggaggagctaagcaagactttc
aagaaattaggtttcgatgtcacggtgcacaaggactgcaagtggcagaagattcgcgaa
aacgtggagaaggcagccgcgcaggaccagacggacaatgactgcctggccattgccatc
ttgtcacacggcgagcatggctgcatttatgccaacgacattcagtacaagctggaccta
atcctccactatttcactgccaagatgtgccccacgctagcgggcaagccgaagctcttt
ttcatacaagcctgccaaggttatctcgtggacgggggcatgatgtggaataagtgccgg
actgaaactgatggggactcgtctatgagctacaaaatacccgtccatgcagacttcctc
atctcctactcgacgattccaggctacacttcctggcgtaatatagacaatggctcgtgg
tacatccagtcacttatcgaggagctgaacagcaatggcaagacggacgacctgctcaca
atgctcacttttgtcagtcagcgcgtggccatcgactttgagtcgaacatgccggacaac
ccaataaaggatggtcagaagcagataccgtgcttcacctccatgctgacgcgcatgctg
cacttcggctacaaaccaaacagaacggaataa

DBGET integrated database retrieval system