KEGG   Drosophila miranda: 108160519
Entry
108160519         CDS       T06132                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108160519
   04215 Apoptosis - multiple species
    108160519
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108160519
NCBI-ProteinID: XP_017150063
LinkDB
Position
3
AA seq 302 aa
MPSTMAPTTSPTAPKLAKFKSSSLDLEIYTANRRGTIATAASDWKALRSSPSNGRSLHAG
GGHGLGLGPGLSSMTRAASTSSLASSTRTMTNYQEYKMEIINQGKCLCGQYIRARLRRAG
VLNRKVIQRLRNILEPSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELED
GDMAPMLLNLVAKDLFRSSITWGKIISIFSVCGGFAIDCVRQGHYDYLQCLVDGLAEIIE
DDLVYWLIDNGGWLGLQQHIRPRVGEFTFLGWLTLFVTISAGAYMVSNVCKRIGCQLYSL
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccatcgaccatggcccccactaccagtccaaccgccccgaagctggccaagttcaag
tcctcatccctggacctggagatctacacggcgaatcgacgcggcacgattgccacggcg
gccagtgactggaaggcactgcgcagcagcccttccaacggacgatctcttcatgccggg
ggcgggcacggtctcggactcggaccaggcctctcctcgatgacccgggccgcatccaca
tcatcactagccagcagcacacgcaccatgaccaactatcaggagtacaaaatggaaatt
attaatcagggcaagtgtctctgtggccagtatattagagcgcggctacgacgggccggc
gtcctcaatcggaaggtgatacaaagactgcgaaacatactggaaccctcttcccatgtg
gtctacgaagtgtttcccgccctcaacagcatgggcgaggaactggagcgaatgcacccg
cgtgtctacacaaacatatccaggcagctatcgagagctccgtttggtgagctggaggac
ggtgatatggcccccatgctgctcaatttggtggccaaggatctcttccggtcgagcatt
acctggggcaagatcatctcaatattttcggtctgtggcggctttgccatcgactgtgtg
cgccagggccactacgactacttgcaatgccttgtggatggcctggccgagataattgag
gacgatctggtgtactggctgatagacaatggcggatggctcggacttcagcagcacata
cgtcctcgcgtgggggaattcacatttctgggctggctgacactgtttgtgactatttcg
gcgggagcctatatggtatctaatgtatgcaaacgcattggctgtcaattgtattctttg
ttgttttag

KEGG   Drosophila miranda: 117193672
Entry
117193672         CDS       T06132                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    117193672
   04215 Apoptosis - multiple species
    117193672
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 117193672
NCBI-ProteinID: XP_033254299
LinkDB
Position
Y
AA seq 302 aa
MPSTMAPTTSPTAPKLAKFMSSSLDLEIYTANRRSTIATAASDWKALRSSPSNGRSLHAG
GGHGLGLGPGLSSITRAASTSSLASSTRTMTNDQEYKMEIINQGKCLCGQYIRARLRRAG
VLNRKVIQRLRNILEPSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELED
GDMVPMLLNLVAKDLFRSSITWGKIISIFSVCGGFAIDCVRQGHYDYLQCLVDGLAEIIE
DDLVYWLIDNGGWLGLQQHIRPRVGEFTFLGWLTLFVTISAGAYMVSNVCKRIGCQLYSL
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccatcgaccatggcccccactaccagtccaaccgccccgaagctggccaagttcatg
tcctcatccctggacctggagatctacacggcgaatcgacgcagcacgattgccacggcg
gccagtgactggaaggcactgcgcagcagcccttccaacggacgatctcttcatgccggg
ggcgggcacggtctcggactcggaccaggcctctcctcgattacccgggccgcatccaca
tcatcactagccagcagcacacgcaccatgaccaacgatcaggagtacaaaatggaaatt
attaatcagggcaagtgtctctgtggccagtatattagagcgcggctacgacgggccggc
gtcctcaatcggaaggtgatacaaagactgcgaaacatactggaaccctcttcccatgtg
gtctacgaagtgtttcccgccctcaacagcatgggcgaggaactggagcgaatgcacccg
cgtgtctacacaaacatatccaggcagctatcgagagctccgtttggtgagctggaggac
ggtgatatggtccccatgctgctcaatttggtggccaaggatctcttccggtcgagcatt
acctggggcaagatcatctcaatattttcggtctgtggcggctttgccatcgactgtgtg
cgccagggccactacgactacttgcaatgccttgtggatggcctggccgaaataattgag
gacgatctggtgtactggctgatagacaatggcggatggctcggacttcagcagcacata
cgtcctcgcgtgggggaattcacatttctgggctggctgacactgtttgtgactatttcg
gcgggagcctatatggtatctaatgtatgcaaacgcattggctgtcaattgtattctttg
ttgttttag

DBGET integrated database retrieval system