KEGG   Drosophila miranda: 108162590Help
Entry
108162590         CDS       T06132                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
dmn  Drosophila miranda
Pathway
dmn04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108162590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmn01001]
    108162590
Enzymes [BR:dmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108162590
Protein kinases [BR:dmn01001]
 Serine/threonine kinases: TKL group
  MLK family
   108162590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 108162590
NCBI-ProteinID: XP_017152900
LinkDB All DBs
Position
XL
AA seq 1218 aa AA seqDB search
MLPISEEQSQKQQHHQHQPSPDNGVDDADAQVGDGSLWTALYDYDAQGEDELTLRRGQIV
VVLSTDSEVSGDVGWWTGKIGDKVGVFPRDFVTDEDPLQLNVPSAIGDIQPHEIEYEEMD
IKEVIGSGGFCKVHRGFYDGEEVAIKIAHQTGDDDMQRMRDNVLQEAKLFWALKHENIAA
LRGVCLKTKLCLVMEYARGGSLNRILAGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHR
DLKSSNVLIYEAIEDNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYS
KSSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGSLMKSCWQ
TDPHKRPGFKEILKQLENIARSKFTLTPQESFHYMQECWKKEIAEVLHDLREKEKELRNK
EEQLLQVQNEQREKATLLKIREQNLREREIELIGRELVMMQPVPKRKPKKGKKQHKPLQI
SLPTEFRHTITAVRDKAEPPGSPSFSGLRLVALTDGHKGKTWGPSTMHQRERSLLPSQLG
GGQPEWPAQTSTHSSFSKSAPNLDKSKQQQQGPGQAMHHPSSASASSTPPPQQQQQLIGG
MGMTVAVAGAGVATTSSFYGGEAAGRATGIPLPYFLTRPNHNNNISTTTFTTNNNNNNSY
NSANNNNNNNSNNNISNQSKTNPIMLPTSSTAFSPASSSIIIHSNASLPHSNSNCSHSHI
QTIRKNSSQSNSNHSSHSHSHSQSKSSAKFYHRARSQEYGLDSATTAYQLSTAPLFLLSD
DSSETDTVTPTTGCFHFLKSSTSTAVAASSSGAAGIGSGVSLIRFGGSLGNSPAVGRKKH
SLDSSHPQAATTSLALPLEARGENNTYDRAFYRQLVKKINASSERVNSKSSGDLTMYNCT
PLTTTMADPLSLDYDDAEEAFEGGGGRFQRNHSVSQFPRHCFFKEPNNSQPQESSSDEDG
VEDENENETDERGLEQTSMDTSSASSQVRQNSTTSRKSSVTFQSVSFEEPTSTSTGTAKA
DPYASSASISFSTSSSSTGGNGDSNDIRHEQTMAMATGSQNGYNMQENYILATRRMQDVQ
PHPDVIKMKQNLLEQEQRLHIKNQKKQRPKHITKSKSVEAPAEPQKSGPQHLHHHHHHSS
GSNKIRSLINIFSRSKKKYSKLSEHAMGGGVHMGSTEFSAIDPYEADLEAAQGGSASRNL
KRKSKKPQTQSCEQLERC
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgctccccatcagcgaggagcagagccaaaagcagcagcaccaccagcaccagccgagt
ccagacaacggtgtggacgatgccgatgctcaggtgggggacggcagcctctggacagcc
ctgtacgactacgatgcccagggcgaagatgagctgacgctgcgccgcggccaaattgtg
gtcgtcctctccacggacagcgaggtctccggcgatgtgggctggtggacgggaaagatt
ggtgacaaggtcggtgtatttccccgtgattttgtcacagacgaagatccgctgcagctg
aacgtgccatcggccattggcgacatccaaccgcacgagatcgagtacgaggagatggac
atcaaggaggtgatcggctctggtggcttctgcaaggtacatcgcggcttctacgatggc
gaggaggtggccatcaagatcgcccaccaaacaggcgacgacgatatgcaacggatgcgc
gacaatgtacttcaggaagcgaaactcttttgggccctcaagcacgagaatatcgccgcc
ctgcgtggcgtctgcctcaagacaaagctctgccttgtgatggagtatgcccgcggaggc
agcctcaatcgcattctggccggcaagataccgccagacgttctggtcaactgggccata
caaattgcccgtggcatgaactatctgcacaacgaggcgcccatgtctattatacaccgt
gacctcaagtcctccaatgtgctcatctacgaggccattgaggacaaccacctgcagcag
aagacgctcaagatcacggactttggactcgcccgcgaaatgtacaacacgcaaaggatg
agcgctgcgggcacctatgcctggatgccgcccgaggtgatcagtgtcagcacgtactcc
aaatcctcagatgtttggagctatggtgtgctgctgtgggagctaatcactggcgagaca
ccgtacaaagggttcgatccgttgtccgtggcgtatggcgtggctgtcaataccctgaca
ttgccgataccaaaaacctgccccgaaacctgggggtctctcatgaagagctgctggcaa
acggatccgcacaaacgacccggattcaaggaaatactcaagcaactggagaacattgcc
cgctccaagttcacgttgacgccgcaggagtcctttcactacatgcaggagtgctggaag
aaggagatagccgaggtcctgcacgatttgcgcgaaaaagaaaaggaactgcgcaacaag
gaggagcagctgcttcaggtccagaacgagcagcgcgagaaggcgaccctcctcaagata
cgggaacagaatctacgggagcgtgagatagagctgattggacgggaattggtcatgatg
cagccagtaccgaaacgaaagcccaaaaagggcaaaaagcaacacaagcccctgcagata
tcattgcccacggagttccggcacaccatcacggccgtgcgcgacaaggcagagccgccg
ggctcaccatccttctccggactacgactcgttgcactcaccgatgggcacaagggcaag
acgtggggaccctcgacgatgcaccagagggagcgctcgctgctgccctcgcagctgggc
ggcggccagccggagtggcccgcacagacctccacccactcgtcgttcagcaagagtgcc
cccaatctggacaaaagcaaacagcagcagcagggtccgggccaggccatgcatcatccg
tcgtcggcctcggcatcgtcgacgccgccgccccagcaacagcagcagctgatcggggga
atgggcatgaccgtggccgtggctggtgctggtgtggcgaccacgtcgtccttctacggg
ggcgaggcggctggcagggccacaggtataccattgccatattttctaacgcgccccaac
cacaacaacaacatctccaccacaaccttcaccaccaacaacaacaacaacaacagctat
aactccgccaacaacaacaacaacaataatagtaataataatattagtaaccagagcaaa
actaatccgataatgctgcccacatcctccaccgcattctcacccgcatcatcatccatc
atcatccactcgaacgcctcattgccccactccaattccaactgcagccacagccacatc
cagacaatccgcaagaacagcagccagagcaacagcaaccacagtagccacagccacagc
cacagccaaagcaaatcttcagccaaattctaccatcgagccaggagccaagagtacggg
ctggacagtgccacaacggcctaccaactctctaccgcgccgctctttctactatcagac
gatagctcggagacggacacggtgacacccaccacgggctgttttcatttcctcaagtcc
agcacctccacggccgtcgccgccagcagcagtggggcagcaggcatcggttcgggcgtg
agtctgatacgtttcggtggcagcctcggtaacagtccagcggtgggccggaagaaacat
tcgctggacagcagccacccgcaggcggccactaccagtctggccctgccgctggaggcg
aggggagagaataatacctacgatcgggccttctaccggcaattggtcaagaaaattaac
gccagcagtgagcgggtaaactccaagtcgagcggagacctgaccatgtacaactgcaca
ccgctgaccactaccatggcggatcccctgagcctggactacgacgatgcagaggaggcc
ttcgagggcgggggcggacgcttccagcggaatcactccgtttcgcagttcccgcgtcat
tgcttctttaaggagccaaacaacagccagccgcaggaaagctccagcgacgaggacggg
gtagaggacgaaaacgagaacgagaccgatgagcgtggactggagcagacgtcgatggat
acgtcgtcggcctcgagccaagtgcgccagaactcgaccacttcgcgcaagagctcggtg
acttttcagagcgtcagcttcgaggaacctacatccacaagcacaggcactgccaaagcc
gatccctatgcgtccagtgcatcgatcagcttctccacctcctcctcatctacgggcggc
aatggagattcaaacgatatcaggcatgagcagaccatggccatggcaaccggcagccaa
aacggctataacatgcaagagaactatattctggccacacgccgcatgcaggacgtccag
ccccatccggatgtgatcaagatgaagcaaaatctgctggagcaggagcagcgcctgcac
atcaagaaccaaaagaagcagcgacccaagcatataaccaaatccaagtccgtcgaggcg
cccgccgagccacagaaatctggcccccagcatctgcaccaccatcaccatcattcctcc
ggctccaacaagattcgctcgttgataaacatcttttcgcgctcgaagaagaagtacagc
aagctgtcggagcatgccatgggcgggggcgttcacatgggtagcactgaattcagtgcc
atcgatccgtacgaggctgatctggaggcggcccagggcggcagcgccagtcgcaacctc
aagcgcaagagcaagaagccccagacgcagtcctgtgagcagttagagcgctgctga

DBGET integrated database retrieval system