KEGG   Drosophila miranda: 108163161
Entry
108163161         CDS       T06132                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dmn  Drosophila miranda
Pathway
dmn00230  Purine metabolism
dmn01100  Metabolic pathways
dmn04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108163161
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108163161
Enzymes [BR:dmn01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108163161
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 108163161
NCBI-ProteinID: XP_017153770
LinkDB
Position
4
AA seq 1190 aa
MPEEKEMSGNNLENGQAMATATATATASSTPSRSKQQRQKTPTRRRPHDSDVVAGGVGIT
GGGVVILPQHVLNELYHNYSIKQRRSGLKWFLFAAVLFNVWTICIPWDQAIPTRVVNCCM
LVAYLALTALMHIGRRSEQPSLRRFHLTFLTIMPRALWFLSMLHFAAYVMLQPSFSPRDV
LGWAILLNFLIYVTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIA
TAALIGLLYYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMRED
LGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKY
QQLRIKILGDCYYCISGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTG
AVLAGILGQRQWQFDVYSKDVELANKMESSGMAGRVHISDKTLAFLNGEFEVEPAFGEKR
EELLRIAGLKTFFITKVVKPFASPCAKKINESQAENSQLSPNGSTTDVVSGGGEDNDATL
DDEELLAQSATTNGHQTAEAEDEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFK
NPQLEQSYAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVV
ISIAESFSGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHI
VSESEFNATAGLGLGLEADVDVDVAGAEAVTAEHLLPESFVEQMRDAVPTERVLYPSYLS
NFGVLILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFIMQDLYALEDDLAHQPIISSRY
CASGLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHV
AEHFMKNTKRSHDDLYSQSYSEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDF
DALLELPQFQDIIKIKTIGSTYMAASGINLQRNLRSDASITERWAQLAVLVEFALELTHT
LQGINEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVT
EETCNILQKFGYTFQQRGLVSVKGKGQLMTYYLQGKSKPCAEPEATPAAIELHDTLDSTT
ELDISDIKTPLLKLKGQEAPAAGESGQSGPAPSLGNGSAGQVGESQSLLE
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgccggaggagaaggaaatgtccggaaataatctggaaaacggacaggccatggccacg
gctacggctacggccacggccagctcaacgccaagcaggtccaagcaacagcgccagaag
acgcccacaaggcggcgtccccatgatagtgatgtggtcgctggaggcgttggcatcacc
ggcggcggcgtggtcatcctgccgcagcatgtgctcaacgagctctatcacaactactcc
attaagcagcggcgcagcggcctcaagtggttcctgttcgccgccgttctcttcaatgtt
tggaccatttgcataccctgggatcaggcaatacccacaagagttgtaaactgttgcatg
ctggtggcctatttggccctaacggccctgatgcacattgggcgacgctcggagcagcct
tcactgagacgtttccatctaacattcctgacgattatgccgcgggctctttggttccta
tccatgctccactttgccgcctatgtgatgctgcaacccagcttctctccaagggatgta
ctgggctgggccatcttgctaaacttcctgatctatgtgacgctgccgcttcctctgatt
ttccttggtctggtgattggcttctgcacgtacttcaattgcctgagcctccccgttggc
ttctctcgtcctgatcccctcatctcggatcaggcggcggccaatgcagttctgatagcc
accgccgccttgatcggtctactgtattactttatgggcgaggccaagcagaagcgagcc
tttttggaggccaaaaagagtctggaggtgaaaatggtcatcgaggaacagtccgccgaa
caggaacgcttactgttgtctgtgctgcccaagcatgtggctatcaaaatgcgcgaggac
ctgggctcatccagttcggaggcattcaaaaagatatacatgagtcgacacgagaatgtg
agcatactatatgcggacatagtgggctttaccgccatctcctcgacatatagcgctcaa
gacttggttaaaatgcttaacgagctcttcgcacgcttcgataggctcgccgagaaatat
caacaattgcgcattaagattctgggcgattgctattattgcattagcggtgcccccgac
gagcgaccggatcatgcggttatgtgtgtgcacatgggactctctatggtgaaggccatc
aagtatgtgcagcagaaggccaattcacctgttgatatgcgtgttggcatacacacgggc
gctgtgctggcagggatactcggccagcggcaatggcagtttgatgtctactccaaggac
gttgagctggctaataaaatggaatccagcggcatggcgggacgcgttcacatttcggac
aaaacgttggccttcctcaacggggagtttgaggtggagcccgcctttggcgagaagcgg
gaggagctattgcgcatagccggattgaagaccttcttcataaccaaggtggttaagccg
tttgcgtcgccctgtgccaagaaaatcaacgaatcgcaagccgaaaactcacagcttagc
cccaatggatccaccaccgatgtcgtttccggtggcggagaggacaacgatgccacgctg
gatgatgaggaactgctggcccagagtgccaccacgaatggccaccaaacagccgaggca
gaggatgaggaggaacaggtcaagttggagaactttaagcagcgcttgaaagacgagctc
gtcactcgagatgggcatgagaacctcaccaaggacaccaacatattcctgcgcttcaag
aacccacaattggagcaatcctatgccgtgtaccgagagccctacagctccctgccgctg
ctggcggcactcctggtgcagtgcatcgacgtgctatactcctacttggtgctgccccgc
tccacgctgcatttcatcaacatagcggcgccactggtgcccattgccatgctggtggtg
atcagcattgctgagagcttcagcggcatgctgcccaagttctttgtggacgtgagcaag
cgcttcaatgacattaccttcgtgcgggaactggcggccataattatcgccctcaccatt
ggcctgagcaatgtcatcgacatgttcttcttcgtcaccttcgtgcgcaccgagcacatt
gtgagcgaaagcgaattcaatgccacggctggtctgggactgggtctggaggccgatgtg
gatgtggatgtggccggcgcggaggcggtcaccgccgagcacctgctgcccgaatcgttt
gtggagcaaatgcgcgatgcagtacccacagaacgtgtcctatatccgtcctatttgagc
aatttcggtgtcctaatattgattgcgattgccgtgattgctcagctcacgcatctgact
aaaatactcctattattgtccattgcggctctgcattgctacttcaacatattcatcatg
caggacctgtatgccttggaggatgacctggcacatcagcccatcatatcctcacgatac
tgtgcctctggacttctgctggtggcagccctagctctgagcaccttggcccgacatatg
gatcacgaggatcgggtgatcttcaaatggaaaaccgaggtggcggaacagaaagagacc
gccaacgatatgcggcagcgtaacgaggccttggtgtacaatgttttacccgttcatgtt
gctgaacatttcatgaagaataccaagcgatcacatgatgatctctactctcagagctat
tccgaggtgggagtattatttgccagcatgccaaacttttcagatttctattcggaggaa
accgtgaataatcagggtctggagtgtctacgttttctaaatgaagttatctctgatttt
gatgcgctattggaactgccacagttccaggatatcatcaaaatcaagactattggctcg
acttatatggccgccagtggcataaatcttcagcggaatcttcgctcggatgcttccatc
accgagcgctgggcccagttggccgtgctcgtcgaatttgcattggaactcacgcacact
ctgcaaggcattaacgagcagtctttcaatcactttgtcctcaagatgggcataaatcat
ggacccataaccgctggtgtgatcggtgctaggaagccgcactatgatatctggggcaat
acggtgaatgtggcatcccgcatggagagcactggcaaggccggcgccattcaggtcacc
gaggaaacgtgcaacattctccagaagtttggctatacatttcagcaacgtggcctggtg
tcggtcaagggcaagggtcaattgatgacctactatttgcagggcaagtctaagccttgt
gcagagcctgaagctactccggcagccattgagctacatgatactctggattccaccacg
gagctggatatctcggacatcaagacgcccctgctcaaactgaagggccaggaggcgcca
gcggcgggggagagtggacagagtgggccggcgcccagtctgggcaatggcagtgccggc
caagtgggagaatctcaatctttattggaataa

DBGET integrated database retrieval system