KEGG   Drosophila miranda: 108163300
Entry
108163300         CDS       T06132                                 

Definition
(RefSeq) cytochrome c-2
  KO
K08738  cytochrome c
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108163300
   04215 Apoptosis - multiple species
    108163300
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 108163300
NCBI-ProteinID: XP_017154000
LinkDB
Position
4
AA seq 108 aa
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggcgttccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccataccgtggaggctggtggcaagcacaaggtcggtcccaatctgcatggtctg
atcggtcgcaagactggccaggctgccggtttcgcatacacggacgccaacaaggccaag
ggaatcacctggaatgaggataccctcttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaatgagcgcggtgatctgatt
gcctacctgaagtctgccaccaagtaa

KEGG   Drosophila miranda: 108163565
Entry
108163565         CDS       T06132                                 

Definition
(RefSeq) cytochrome c-1
  KO
K08738  cytochrome c
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108163565
   04215 Apoptosis - multiple species
    108163565
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108163565
NCBI-ProteinID: XP_017154419
LinkDB
Position
4
AA seq 105 aa
MGGGDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGV
VWSDSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 318 nt   +upstreamnt  +downstreamnt
atggggggcggtgatgccgacaacggcaagaagatttttgtgcagaagtgcgcccagtgc
cacaccgtcgaatcggggggcaagcacaaggttggccccaatctaagcggcattgtggga
cgcaaatccggctctgctccgggcttcaaatacacagatgctaatcaaaagaagggcgtt
gtttggagcgattcgacgctggacgagtacctcaaggatccaaagaaatacatacccggc
actaagatggttttcgcaggactcaaaaaggccgaagaccgtgccgatttgattgcatac
cttaagaaaaataagtaa

DBGET integrated database retrieval system