KEGG   Drosophila miranda: 108164090
Entry
108164090         CDS       T06132                                 

Definition
(RefSeq) septin-5 isoform X1
  KO
K16943  septin 4
Organism
dmn  Drosophila miranda
Pathway
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108164090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmn04131]
    108164090
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dmn04812]
    108164090
Membrane trafficking [BR:dmn04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    108164090
Cytoskeleton proteins [BR:dmn04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     108164090
SSDB
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU Ras AIG1 AAA_22 Roc AAA_16 VirE AAA_29 ABC_tran AAA_7 IIGP
Other DBs
NCBI-GeneID: 108164090
NCBI-ProteinID: XP_017155172
LinkDB
Position
XL
AA seq 467 aa
MKHQPPPPPLPLTQPPSLGGGGVGGVSGSVISSSSGSSSIVANAISSLNGNNSATSSSSC
IQPANNNNNHNNNINNISSSFEAGKSRPPLYPKPKTPSFDKDRDYIGFATLPEQVHRKSV
KRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTRVEKKTMDIEERG
VRLRLTVVDTPGFGDAINCEDSWRVCTSYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYF
VPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQ
FPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSD
FIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDA
AISETDRLLLQKDEEIRRMQDMLTQMQEKLKQTHLMEMKKNDSVIDV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaaacaccagccgccgcctcctccgctgcccttaacgcagcccccatcgctgggtggc
ggcggggttggtggggtctctggcagcgtcatcagcagcagcagtggaagcagcagcata
gtggccaatgccattagcagcctcaatggcaacaacagtgccaccagcagcagcagttgc
attcaaccagccaacaacaacaacaatcacaacaacaacatcaacaacatcagcagcagc
tttgaggcaggaaaatctcgtccacccctctacccaaaacccaagacaccctcgtttgac
aaggaccgtgactacattgggtttgccacgctgccggagcaggtgcaccggaagtcggtg
aagcgtggcttcgagttcacgctgatggtggtcggggagtccggcctgggcaagtcgacg
ctcatcaacagcctcttcctcggtgacctgtacaagaaccgccagatgcccaacgtggag
gagcgcatcgagaagacgacccgcgtcgaaaagaagaccatggacatcgaggagcgcggc
gtccggctgcgcctcactgtggtggacacgcccgggttcggggatgccatcaactgcgag
gacagctggcgggtgtgcacctcgtacatcgacgagcagttccgccagtacttcaccgac
gagagcggactgaatcggcgcaacatacaggacaaccgagtgcactgctgcctctacttt
gttccgccctgggggcacagcctgcgacagatggatctggacctgatcaggcggctgcat
cgcaaggtgaacattgtgctggtgattggcaaggcggactgcctgaacaagcaggaggtg
cgcaagctcaaggagcgcatactgcaggacctcgaggacaatcacatacagctgtaccag
ttccccgaatgcgactccgacgaggacgatgacttcaagcagcaggaccgcgagctgaag
gcctccattccgttcgccgtcgttggcagcaacaccattctggaggtcgccggcaagaag
gtgcgcggccgccagtacccctggggtgtggtcaatgtggaggatccggagcacagcgac
ttcataaagctgcgcaccttcttgatatccacgcacatgcaggacttgaaggataccaca
caggatgtgcactacgagaacttccgggcgcagtgcatctcacagatctcgcagcatgcg
ctgcgggagcgcggcaagttgaagcgcgactcgatcagctcgacgaacggattcgatgcg
gccatttcggagacggacaggctgctgctgcaaaaggacgaggagatcagacgcatgcag
gacatgctcacccagatgcaggagaagctcaagcaaacgcatctcatggagatgaagaag
aacgacagcgtgatcgatgtctag

DBGET integrated database retrieval system