KEGG   Drosophila miranda: 108164595
Entry
108164595         CDS       T06132                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X1
  KO
K16679  wengen
Organism
dmn  Drosophila miranda
Pathway
dmn04013  MAPK signaling pathway - fly
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
dmn04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108164595
   04391 Hippo signaling pathway - fly
    108164595
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108164595
   04215 Apoptosis - multiple species
    108164595
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 108164595
NCBI-ProteinID: XP_017155911
LinkDB
Position
XL
AA seq 428 aa
MFRVDGWVHSSFSHSFFSIAPAQTSHEPCGSFTIQLIIFFETILTGRPLKGPQKRELMMP
PRLPHSSGVAAAAATKRVTTSRSISSHNNHFIHSRSTTNTTFHKRRRRRHDISNATDATS
DATVAPAPARCSITWRAPAIIHLALLLLSTTCSLRTVAASSASSTSSSSAATTSASASGS
GSASEIASSSPCAPQHWWDPLRDKCTACTVCLGEMIPLRPCQLHTNTICGSIYDLKIDWV
VLAKTEPNWKERRKSSEYEHFEQDAPLQHLTHEQLQQLHEEAAAAWVLDWQTGVLYVAVL
TCLIFFSVAACILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGTFFIGNADA
LRGLPAAAASHAASAAQSGIFQPQHVLLPEKHQGKHQERRILKTLQPGNVYIEENNGGMM
GIGASSKG
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgtttcgcgtggatgggtgggtgcattcatcattcagtcattcattcttctcgattgca
ccggcgcagacgagccacgaaccgtgcggatcgttcactattcagctcataatttttttc
gaaaccattctaaccggacgccctttgaagggaccccagaaacgtgaattaatgatgccg
ccaagactgccccatagctctggagtagcggcagcagcagcaacgaaacgagtaaccacg
agtagaagtattagcagccacaacaaccacttcatccatagcagaagcaccaccaacaca
acatttcacaagcgccgacggaggcgacatgacatcagcaacgccacagatgcaacatca
gatgccactgtagcacctgcccctgccaggtgcagcatcacgtggagagcgcctgccatc
atccatttggcgctacttcttctctccaccacctgctccctgaggactgttgcggcttca
tcagcatcttctacatcatcatcatccgcagctactacatccgcgtccgcttcaggatct
ggatcagcatcagaaatcgcctccagctccccctgcgccccacagcactggtgggacccg
ttgcgggacaagtgcaccgcctgcaccgtctgcctgggcgagatgatccctctccggccc
tgccagctgcacacgaacactatctgcggctccatctacgacttgaaaatcgattgggtc
gtcctcgccaagacggagcccaattggaaggagcgccgaaagtcctcagagtatgagcac
ttcgaacaggatgccccgctgcagcatttgacccacgagcaactgcagcagctgcacgag
gaggcggccgctgcctgggttctcgactggcagacgggggtcctctatgtggccgtcctc
acctgcctcatcttcttctcggtggccgcctgcatcctcatccaccacatgcgccagtgg
cgacgcatggagcggcgcttggatcaagacgtggaggagctgtcgacgaagttgatggcc
aagctggcggaggtgcagagcctggacggaggaacctttttcattggcaacgctgacgcc
ttgcgtggattgcccgctgccgccgcctcgcatgcggcctcggcggcgcagtcggggatc
ttccagccgcaacatgtgcttctgcctgagaaacatcagggtaagcatcaggagcgacgg
attctgaagaccctgcagcccggtaatgtctacatcgaggagaacaatgggggcatgatg
ggcataggtgccagctccaagggttga

DBGET integrated database retrieval system