KEGG   Drosophila miranda: 108165515
Entry
108165515         CDS       T06132                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108165515
   04215 Apoptosis - multiple species
    108165515
SSDB
Other DBs
NCBI-GeneID: 108165515
NCBI-ProteinID: XP_017157060
LinkDB
Position
XR
AA seq 155 aa
MAIAYFIPDQAQLLARSNQQSAQQAAASTGAVPQQQQPGQQPGQQAGQQQAGQQAPQPQT
SQQRQQRPQFRANISVPLGRQQGAMSMSEFGCWDLLAQIFCYALRIYSYNSSQRRPTVIQ
ISFEIRSGGQEQQQQQQEDQEEHQPDATDATGKGN
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccattgcatatttcatacccgaccaggcccaactgctggccagaagcaatcagcaa
agtgctcaacaggccgccgcctcaacaggagccgtgccccagcagcagcagccaggacaa
cagccaggacagcaggcaggacaacaacaggcaggacaacaggcaccgcagccgcagacg
agtcagcagcgacagcaacgtccccagttccgtgccaacatatccgtgcctctgggccgg
cagcagggagccatgagcatgtccgagttcggctgctgggaccttctggcccagatcttc
tgctatgccctcagaatctacagctacaactccagccagcgccggcccacggtcattcag
atctccttcgagatcaggagcggcggccaggagcagcagcagcagcagcaggaggatcag
gaggagcaccagccggatgcgactgatgccacaggcaagggcaactaa

DBGET integrated database retrieval system