KEGG   Drosophila miranda: 117188200
Entry
117188200         CDS       T06132                                 

Definition
(RefSeq) caspase-1-like isoform X1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    117188200
   04215 Apoptosis - multiple species
    117188200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmn01002]
    117188200
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     117188200
Peptidases and inhibitors [BR:dmn01002]
 Cysteine peptidases
  Family C14: caspase family
   117188200
SSDB
Motif
Pfam: Peptidase_C14 B5
Other DBs
NCBI-GeneID: 117188200
NCBI-ProteinID: XP_033247574
LinkDB
Position
3
AA seq 285 aa
MTDEFISRSFITGDSTDVAGGATVGSRSTRKRVARYAREYNMNHKNRGLALIFNHEFFKI
PTLQTRLGTNVDAEELSKTFKKLGFDVTVHKDCKWQKIRENVEKAAAQDHTDNDCLAIAI
LSHGEHGCIYANDIQYKLDLILHYFTAKMCPTLAGKPKLFFIQACQGYLVDGGMMLNKCQ
TETDGDSSMSYKIPVHADFLISYSTIPGYTSWRNINNGSWYIQALIEELNSNGKTDDLLT
MLTFVSQRVAIDFESNMPDNPINDRQKQIPCFTSMLTRMLHFGYK
NT seq 858 nt   +upstreamnt  +downstreamnt
atgacggacgagttcataagcaggagctttattactggcgattcaacggacgtagctggt
ggtgcaacggttggatcgcgtagtacccgaaagcgtgtggcgcgctatgccagggagtac
aatatgaatcataagaatcggggattggccctaatattcaatcatgagtttttcaagata
cccacgctgcagactcgcttgggcaccaacgtggacgcggaggagctaagcaagactttc
aagaaattaggtttcgatgtcacggtgcacaaggactgcaagtggcagaagatacgcgaa
aatgtggagaaggcagccgcgcaggaccacaccgacaatgactgcctggccattgccatc
ttgtcacacggcgagcatggctgcatttatgccaacgacattcagtacaagctggaccta
atcctccactatttcactgccaagatgtgccccacgctagcgggcaagccgaagctcttt
ttcatacaagcctgccaaggttatctcgtggacgggggtatgatgttgaataagtgccag
actgaaactgatggggactcgtctatgagctacaaaatacccgtccatgcagacttcctc
atctcctactcgacgattccaggctacacttcctggcgtaatataaacaacggctcgtgg
tacatccaggcacttatcgaggagctgaacagcaatggcaagacggacgacctgctcaca
atgctcacttttgtcagtcagcgcgtggccatcgactttgagtcgaacatgccggacaac
ccaataaacgatcgtcagaagcagataccgtgcttcacctccatgcttacgcgcatgctg
cacttcggctacaaatag

DBGET integrated database retrieval system