KEGG   Drosophila mojavensis: Dmoj_GI10464Help
Entry
Dmoj_GI10464      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dmoj_GI10464
Peptidases [BR:dmo01002]
 Metallo Peptidases
  Family M2
   Dmoj_GI10464
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI10464
CD molecules [BR:dmo04090]
 Proteins
  Dmoj_GI10464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 CHD5
Motif
Other DBs
NCBI-GeneID: 6576923
NCBI-ProteinID: XP_002002903
FlyBase: FBgn0133228
UniProt: B4KI52
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MRSLLVYCLVAFALVPWLPYGTAYETCSASAQQAHCFFEQENSKLRERYHSEYSAAFTYN
TNVTEENRQAMIAVYAEGARQNKLLAQTIRAANYAKSEDGNIRRQARMLQELGADVLEPS
DYLELKNAISAMQSNYATTTVCSYTNRTNCSLTLEPHIQERLSNSRDPAELAWYWREWYD
KAGTPMRDNFAKYVRLTRKAANMNGYRSYADYWVHFYEDATFESQLDATYKALLPFYRQI
HGYVRYRLRQHYGPEVVPAEGNIPMHLLGNMWGQSWNEVIDLFTPYPERPFVDVTSEMER
QAYSVQKLFELGDQFFQSLGMRALPTTFWNRSVLTRPADREVVCHASAWDFYQDSDVRIK
MCTEVNTHYLYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLQ
SINLTSNGTLDEESRINELFKRALSKIVFLPFGYTMDKYRYAVFRGELDESQWNCGFWQM
RSEFGGVEPPMARSDKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRLAGQYAPGD
STRTLDNCDIFGSRRAGDAFKKFLSAGNSRHWKEVLEEFTGETEMDPAALLEYFDPLYQW
LKRENKRLGVPLGWEETNKIPSNCCGAFST
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtctgctagtatattgcttggtggcctttgcacttgtgccgtggctgccctat
ggaactgcgtatgagacttgttccgcctcggcgcagcaggctcattgctttttcgagcag
gagaattcgaagttgcgtgaacggtaccattccgaatattccgctgcattcacgtacaac
accaacgtgacggaggagaatcgtcaggccatgatagcggtctatgctgaaggcgccagg
cagaacaaattattggcgcagactattcgagcggccaactatgccaagtcggaggatgga
aacattcgcaggcaggcgcgaatgctccaggaactaggtgcggatgtactcgagcccagt
gactatttggagttgaagaacgcaataagcgccatgcaatccaattatgccaccaccact
gtttgctcctacacgaatcgcaccaactgctccttgacgcttgagccgcacatccaagag
cgtctgtccaacagtcgcgatccggccgagctggcctggtattggcgcgaatggtacgat
aaggcggggacaccaatgcgtgataactttgccaaatatgtgcgattgacgcgcaaagca
gccaatatgaatggctatcgctcgtatgccgattactgggtccacttctatgaagatgcc
acctttgagagccagctggacgccacctacaaagcattgctgcccttctacagacagatc
catggctatgtgaggtaccgtctgcgccagcattatggacccgaggtggtgcccgctgag
ggcaacattcccatgcatctgctgggcaacatgtgggggcagtcgtggaacgaggtcatc
gatctgttcacaccgtatccggagaggccatttgtggacgtcacatcggaaatggagcga
caggcatatagcgtgcagaagctgttcgagctgggcgaccagttcttccaatcactgggc
atgcgcgctctgcccacgactttctggaatcgaagtgtgctcacacgacccgcagatcgc
gaagtggtgtgccacgcctctgcctgggacttttatcaggacagcgatgtccgcatcaag
atgtgcaccgaggtgaacacccattacctgtacgtggtgcaccatgagctgggccacatt
caatactatttgcaatacgagcaacagcccgctgtttatcgaggagcccccaatccgggc
ttccatgaagctgtgggtgatgtcatagcgctgtcggtaatgtccgccaaacatctgcag
agcatcaacctcaccagcaacggaactctagacgaggagagccggatcaatgagctgttc
aagcgagcgctctccaagattgtcttcctgccctttggctacaccatggacaagtatcgc
tatgctgtgttccgcggcgagctggacgagtcgcaatggaactgcggcttctggcagatg
cgttccgagttcggtggcgtcgaaccaccaatggctcgcagcgacaaggactttgatcct
ccggccaagtaccacattgatgccgatgtcgagtatctgcgctactttgctgcccacata
ttccaattccaattccacaaggctctgtgccgtctagccggacagtatgcgcctggcgac
agtacccgaactctggacaattgcgacatctttggcagccgaagggcgggcgatgcattc
aagaaattcttgtcggctggcaattcgagacactggaaggaagtcctggaggagtttacg
ggcgaaactgaaatggatccagctgcactactcgaatactttgatccactctatcaatgg
ctcaagcgcgagaacaagcgcttaggcgttcccttgggctgggaagagaccaataaaatc
ccatccaattgctgtggcgcctttagtacttaa

DBGET integrated database retrieval system