KEGG   Drosophila mojavensis: Dmoj_GI11258Help
Entry
Dmoj_GI11258      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11253  histone H3
Organism
dmo  Drosophila mojavensis
Brite
Chromosome and associated proteins [BR:dmo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmoj_GI11258
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI11258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 6587054
NCBI-ProteinID: XP_002012640
FlyBase: FBgn0134019
UniProt: B4K7B0
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacaaagcagaccgctcgtaagtcaactggtggcaaggctcctcgtaagcag
ttggctactaaggcagcacgtaaaagtgcaccagctactggcggtgtgaaaaaacctcat
cgctatcgccctggtacagttgctctgcgtgaaattcgtcgttaccagaagagcacagag
ttgcttattcgcaagttgccgttccagcgtttagtccgtgaaatcgctcaagacttcaag
actgaccttcgtttccagagctcagctgtgatggctctacaggaagctagcgaagcctac
ttggttggcctattcgaagatacaaatttgtgcgccatccatgctaagcgcgtcaccatt
atgcccaaggacattcaactggctagacgtatccgtggcgagcgcgcataa

DBGET integrated database retrieval system