KEGG   Drosophila mojavensis: Dmoj_GI11624Help
Entry
Dmoj_GI11624      CDS       T01062                                 

Gene name
Dmoj_Sod1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04146  Peroxisome
dmo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmoj_GI11624 (Dmoj_Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmoj_GI11624 (Dmoj_Sod1)
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dmoj_GI11624 (Dmoj_Sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 6583103
NCBI-ProteinID: XP_002008781
FlyBase: FBgn0134384
UniProt: B4L175
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MVAKAVCVINGDAKGTVFFEQEADGCPVKVTGEVTGLAKGQHGFHVHEFGDNTNGCMSSG
PHFNPFQKEHGAPTDENRHLGDLGNIVATGDGPTPVDICDCKITLFGANSIIGRTVVVHA
DADDLGKGGHELSKTTGNAGARIGCGVIGIAKI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaaagctgtatgcgttatcaatggtgatgccaagggcaccgttttctttgaa
caggaggcggacggctgcccggtgaaagttacaggagaagttactggcttggcgaagggt
cagcatggcttccatgtgcacgagtttggcgacaacacgaacggctgcatgtcctcagga
ccgcatttcaatccattccagaaggaacatggcgctccgactgacgagaatcgtcattta
ggtgatctgggcaatattgtagccaccggcgacggacccactccagtcgacatatgcgat
tgcaaaatcacgttgtttggagccaatagcattatcggacgcactgttgtggtacatgct
gatgctgacgacttaggcaaaggtggtcatgagctgagcaagacaactggcaacgctggc
gctcgcatcggttgcggcgtaattggaattgccaaaatctaa

DBGET integrated database retrieval system