KEGG   Drosophila mojavensis: Dmoj_GI11719
Entry
Dmoj_GI11719      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20014  cell death protein rpr
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI11719
   04215 Apoptosis - multiple species
    Dmoj_GI11719
SSDB
Motif
Pfam: MtrG DUF3177
Other DBs
NCBI-GeneID: 6582930
NCBI-ProteinID: XP_002008612
FlyBase: FBgn0134478
UniProt: B4L053
LinkDB
Position
Unknown
AA seq 67 aa
MAVAFYIPDQKEMLRKAREQEKQLLRLRQWQMATVVLNTIRQLMDSTASECVQRAGRKCG
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggctgtggccttctacataccggatcagaaggaaatgctgcgcaaggcgcgcgaacag
gagaaacagctgttgcgcctacgtcaatggcaaatggcaacagttgtattgaacacgata
cgccagctaatggactccacggccagcgagtgcgtgcagcgagcgggacgtaagtgtggc
aagtggcgcaaaccatcgcagtga

DBGET integrated database retrieval system