KEGG   Drosophila mojavensis: Dmoj_GI11722
Entry
Dmoj_GI11722      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20018  cell death protein Grim
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI11722
   04215 Apoptosis - multiple species
    Dmoj_GI11722
SSDB
Motif
Pfam: TFIIA Presenilin eIF-3_zeta Spt20
Other DBs
NCBI-GeneID: 6582927
NCBI-ProteinID: XP_002008609
FlyBase: FBgn0134481
UniProt: B4L050
LinkDB
Position
Unknown
AA seq 151 aa
MAIAYFIPDQAQLLARSRQQQASAQQAGGGVGSSPTNPRQNETRQQQQQPQQQQQQRQQQ
QQRTGSSQFRANISVPLGREQGAMSMSEFGCWELLAQIFCYALRLYSYNPAQRRPTVIQI
SFEISSSGAGEANADGGAADAAGDVTDAKQE
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcaatcgcttactttatacccgatcaggcgcagctgttggccagaagcaggcaacaa
caggcaagtgcgcaacaagcaggaggcggcgtcggctccagtccaacgaatcccaggcaa
aacgagacccgacaacagcaacagcaaccacaacaacaacaacaacaaaggcaacaacaa
caacaacgcaccggcagctcacagtttcgcgccaacatttcagtgccgctgggccgcgaa
cagggcgccatgtccatgtcggagtttggctgctgggagctgttggcccagatcttctgc
tacgccttgcgactgtacagctacaatccagcacagcgccggccgacggtcatacagatc
tcgttcgagattagcagcagcggtgcaggcgaggcgaatgcggatggtggagcagccgat
gcggccggagatgtgacagatgcgaagcaggagtag

DBGET integrated database retrieval system