KEGG   Drosophila mojavensis: Dmoj_GI11974Help
Entry
Dmoj_GI11974      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00480  Glutathione metabolism
dmo00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmoj_GI11974
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI11974
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dmoj_GI11974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6582461
NCBI-ProteinID: XP_002008162
FlyBase: FBgn0134731
UniProt: B4KXF2
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MSSGRHLAKGSGTPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPDW
LFEKNPEGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQEKLLIER
FGPVLGAFFKASDGGDLEPFWSGLDIYERELSRRGTLFFGGEQTGILDYMIWPWCERLEL
LQLQRGDDYNYDEKRFPKLTEWRERMKRDPAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcagacacttggcaaaaggctctgggacgcccgatgtgcctgaggatggc
atcttaaggctctactccatgcgcttctgcccctttgcccagcgcgtgcatctggtgtta
gatgccaaacagataccctatcacagcatttatataaacctcacagataagccagattgg
ctgttcgaaaagaatcccgagggcaaggttccagcgctggagctagtgcgcgagccaggt
ccgcccgtccttaccgagtcgctgctcatatgcgagtacctggacgagcagtatccactg
cgtccgctctacccacgtgatccgctgaaaaaggtgcaggagaagctgctcatcgaacgc
tttggtcccgttctcggcgccttcttcaaggcctctgatggcggcgacctggaaccgttc
tggagtggcctcgacatatacgagcgagaactgagcaggcgtggcacactcttctttggc
ggcgaacagacgggcatattggattacatgatctggccctggtgtgagcgactagagctg
ctacagctacagcgtggcgacgactacaactatgacgaaaaacgttttccaaagctgacg
gaatggcgagagcggatgaaacgtgatcctgctgtgatggccttctatatggaagccgag
gtgcaggccgagttcttgcgcacgcgcagcgccggcaaacccaactacaatcttttggtc
aaggatgcctaa

DBGET integrated database retrieval system