KEGG   Drosophila mojavensis: Dmoj_GI14047Help
Entry
Dmoj_GI14047      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmo01001]
    Dmoj_GI14047
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     Dmoj_GI14047
Protein kinases [BR:dmo01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   Dmoj_GI14047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH Tyrosinase
Motif
Other DBs
NCBI-GeneID: 6585800
NCBI-ProteinID: XP_002011426
FlyBase: FBgn0136801
UniProt: B4L7C2
LinkDB All DBs
Position
Unknown
AA seq 432 aa AA seqDB search
MPLFGKKDSGKRPKSKDTKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDTPGDHFAV
KIIDKKALKGKEESLENEIRVLRRFSANHFDGNSPNGTRLTHPNIVQLLETYEDKAKVYL
VMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPE
DDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCG
YPPFYDENDANLFAQILKGEFEFDSPYWDEISESAKHFIKNLMCVNVEKRYTCKQALGHP
WISGNEASSKNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALSSNSSGSADGHSS
LNTSTATTATATATDNGNGRNCVKDAEGEANVGAIKQSSSATSAPSLNESPHADIKNHQR
ISPNCSFSGKAN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccactgtttggcaaaaaagattctggcaaaaggcccaagtcgaaggacacgaaggaa
ctaaacaaacaggtctcaattgaagagaaatacaatctgcacggtctactcggaaccggc
gcattttccgaagtacgcttagcggaaagcaaagatacgccgggcgatcactttgcagtt
aaaatcattgataaaaaggcactgaaaggaaaagaggaatctttggaaaatgaaatacgt
gttctgcgaaggtttagtgcaaaccattttgatggcaacagtccgaatggaacgcgactc
acccacccgaatatagtgcaactacttgagacatatgaagacaaggctaaggtgtatctg
gtcatggaattggtaacaggtggagagttgttcgatcgtatcgtagagaagggctcatat
acggagaaggatgcatcacacttaattagacaaatcttagaggctgtagactatatgcat
gagcagggcgtagtacacagagatcttaagcccgaaaacttactttactacagtccagaa
gatgatagtaaaataatgataagtgattttggtttatcaaaaatggaggattcgggaatt
atggcaactgcttgcggaactcctggctatgtggcaccagaagtgctcgcccaaaaacct
tatggcaaagccgttgatgtatggagcataggcgttatatcctatatactactttgcgga
tatcctcccttttatgatgaaaacgatgccaatttatttgcacaaattcttaaaggtgaa
tttgaattcgattcgccatattgggacgaaataagcgagtcagccaagcactttattaaa
aacttaatgtgtgtcaatgtagaaaagcgatatacttgcaagcaagctttgggacatcca
tggatatctggtaatgaggctagcagcaagaatattcatggcactgtctcggagcagctg
aagaaaaactttgctaagagtcgatggaagcaagcatattatgccgcaacagtcatacga
caaatgcagcgaatggcgcttagtagcaatagcagcggatcagcagatggccattcctct
ctcaatacatcaacagcaacaactgcaactgcaactgcaactgacaatggaaatggccga
aactgtgttaaagatgccgaaggcgaagcaaatgttggagctatcaaacaatcatcctca
gcaacgagcgcgccgtctttaaatgaatccccgcacgcagatattaagaatcaccaaaga
atctcgccaaattgtagtttcagtggcaaagcaaactaa

DBGET integrated database retrieval system