KEGG   Drosophila mojavensis: Dmoj_GI14410Help
Entry
Dmoj_GI14410      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04013  MAPK signaling pathway - fly
dmo04120  Ubiquitin mediated proteolysis
dmo04140  Autophagy - animal
dmo04144  Endocytosis
dmo04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmoj_GI14410
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI14410
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmoj_GI14410
   04140 Autophagy - animal
    Dmoj_GI14410
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI14410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI14410
   04121 Ubiquitin system [BR:dmo04121]
    Dmoj_GI14410
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     Dmoj_GI14410
Membrane trafficking [BR:dmo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    Dmoj_GI14410
Ubiquitin system [BR:dmo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    Dmoj_GI14410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_4 zf-RING_UBOX zf-C3HC4_3 Prok-RING_4 zf-RING_5 U-box zf-RING_6 zf-rbx1 Sina XhlA
Motif
Other DBs
NCBI-GeneID: 6586198
NCBI-ProteinID: XP_002011821
FlyBase: FBgn0137162
UniProt: B4L8G7
LinkDB All DBs
Position
Unknown
AA seq 437 aa AA seqDB search
HNSNINSNGTHIAGCSNATPTTAATTSAAVGATGVTPPRTLALNQNYAASDTSGEHDGDT
DYPDSRYECAICIDWLNEPVLTSCGHRFCKSCLSDWLQNHNQCCPLDNKQLSAEQDIFPD
NYTRREIEQIKHKCPNSPHGCVVVASPIELHRHLPTCPYRRQQQQQLEEKCPFASIKCGF
VGRPETNQLEEHLKTDMPHHMQLMLQAFQQTAIETWQPHKPSSSSALENGHKAGQLPPPP
QYANGVDEQIVQTMYQRIVVLEQRTREQETRIENLNKQLRRQQPIDARYSNGTIVWQIEQ
LSSLIERLRANANNQVYSHECYTSPYGYKFCARLNIQPRKPHVLSLHVHLMQSDNDFHLD
WPFKGRIKLCMVHPGDASLSQHDTIMTKPEILAFHQPREAISTRGFGFLEYANISNIMQL
GFCADNRLLIKIEINIV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
cataacagtaatattaacagcaatgggacgcacattgctggctgcagcaatgccacgccc
acaacggctgcaacaacgagtgcagctgttggcgccacaggagtgacgccgcctcgtacc
ttggcactaaaccaaaactatgcagcttcggacacatcaggggagcacgatggggacacg
gactacccggactcgcggtatgagtgcgccatttgcatagactggctaaacgagccggtg
ctgacgtcatgcggccatcgcttctgtaagagctgcctcagtgattggctgcagaaccac
aaccagtgctgcccactcgacaacaagcagttgtccgccgagcaggatatttttcccgac
aattatacgcgtcgcgagattgagcaaatcaagcacaaatgccccaattcgccgcatggt
tgtgtcgtggtagcctcgcccatcgagctgcatcggcacttacccacctgcccgtatcgc
aggcagcagcagcagcagctcgaagagaagtgtcccttcgccagcatcaaatgcggtttt
gtgggtcgtcctgagacgaaccagttggaggagcacctcaaaacggacatgccgcaccac
atgcaactcatgctacaggcattccaacaaacagccattgagacttggcagccacacaag
cccagctccagctccgcgctggagaacggccacaaggcgggacagctgcccccgccgccg
caatatgcgaacggagtcgacgagcagatcgtccagaccatgtaccagcgcatcgtcgtg
ctggagcagcgcacacgcgagcaggagacacgcatcgagaatctcaacaagcagctgcga
cgccagcagccaatcgacgcccgctacagcaacggcaccatcgtctggcagatcgagcag
ctgagctccttgatagagcgcctgcgcgccaatgcgaataaccaggtgtactcgcacgag
tgctatacgtcaccgtacggctacaagttctgtgcccgtctcaacatacagccgcggaag
ccgcacgtgctcagtctgcacgtgcatctgatgcagtcggacaacgacttccacttggac
tggccattcaagggtcgcatcaagctctgtatggtgcacccgggcgacgcgagtctgtca
cagcacgacaccatcatgacgaagccagagatactcgccttccaccagccgcgcgaggct
atcagcacacgcggcttcggatttctcgagtacgccaacatatccaatatcatgcaactg
ggcttctgtgccgacaatcggctcctgatcaagattgagattaacattgtgtga

DBGET integrated database retrieval system