KEGG   Drosophila mojavensis: Dmoj_GI14754Help
Entry
Dmoj_GI14754      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00051  Fructose and mannose metabolism
dmo00052  Galactose metabolism
dmo00500  Starch and sucrose metabolism
dmo00520  Amino sugar and nucleotide sugar metabolism
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
Module
dmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dmo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI14754
   00051 Fructose and mannose metabolism
    Dmoj_GI14754
   00052 Galactose metabolism
    Dmoj_GI14754
   00500 Starch and sucrose metabolism
    Dmoj_GI14754
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI14754
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dmoj_GI14754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI14754
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dmoj_GI14754
Membrane trafficking [BR:dmo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dmoj_GI14754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 EloA-BP1 FAM199X
Motif
Other DBs
NCBI-GeneID: 6584668
NCBI-ProteinID: XP_002010312
FlyBase: FBgn0137505
UniProt: B4L1J3
LinkDB All DBs
Position
Unknown
AA seq 547 aa AA seqDB search
MDQEQQQLNGAMRSVSINSNGLATKLNGHNGCKGTDETDNVRVQPAAASGVSFTIGSETS
KATNAANSATAATAATANANANAIQIQTSAAGASAAEKKKMVHELCQQLLLTDEQVQELC
YRILHEVRRGLAKDTHAKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQEN
NDFQMESRIYAIPQHIMIGSGRQLFDHIAECLSNFMAEHNVYSERLPLGFTFSFPLRQLG
LTKGLLETWTKGFDCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNH
NCKIGLIVGTGSNACYVEKVEEAELFDMADNNKPHVLINTEWGAFGDNGALDFVRTEFDN
DIDSHSINPGKQTFEKMISGMYMGELVRLVLVKMTQNGVLFNGQGSEVLFTRGLFFTKYV
SEIEADEPGTYTNCRLVLEELGLSNATDGDCANVRYICECVSKRAAHLVSAGIATLINKM
DEPHVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAVACR
EDILNSK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagagcagcagcagctgaatggcgcgatgcgcagcgtttctataaatagcaac
ggactagccacaaaactgaatggccacaacggctgcaaaggcaccgacgaaacggacaat
gtaagagtgcagcccgcggcggcgagcggcgtcagcttcactatcggcagcgaaacgagt
aaagcgacaaatgcagcgaattcggcgactgcggcgaccgcggcgacagcgaacgcaaat
gcaaatgcaattcaaatacaaacatcagcagctggtgcgagtgcagcggaaaaaaagaaa
atggtgcacgagttatgtcagcagctgttgctaaccgatgagcaggtgcaggagctgtgc
tatcgcatactgcacgaggtgaggcgcggcctggccaaggacacgcacgccaaggcgaat
gtcaaatgtttcgttacctacgtccaggatctgcccaatggcaatgagcgcggcaagttc
ctggccctcgatctgggcggcaccaatttccgtgtgcttctcatccacctgcaggagaac
aacgacttccagatggagtcgcgcatctatgcgataccgcagcacatcatgatcggctcc
ggccgtcagctgttcgatcatattgccgaatgtttgtccaattttatggccgagcataat
gtgtactcggagcgcctacctctgggattcacgttttcgttcccgctgcgccagctgggc
ctgaccaagggcctgctcgagacctggacaaagggcttcgactgtgccggcgttgtcaac
gaggatgtcgtccagctgctcaaggatgcgatcgcgcgccgcggcgacgtacaaatcgat
gtctgtgccatactcaacgacacgacgggcaccctgatgagctgcgcctggaagaaccac
aactgcaagatagggctcattgtcggcaccggctccaatgcctgctacgtggagaaggtc
gaggaggccgagctcttcgacatggccgacaataacaagccgcacgttctcatcaacacg
gagtggggcgcgttcggtgacaacggagcactcgactttgtgcgcaccgaattcgacaac
gacatcgacagccacagcatcaatcccggcaagcagacgttcgagaagatgatctcgggc
atgtacatgggcgagctggtgcgcctggtgctggtcaagatgacacagaatggcgtgctc
ttcaatggccaaggatcggaggtgctgttcacgcgcggcctcttcttcaccaaatacgtg
agcgaaattgaggccgatgagcccggaacatacaccaactgccgcctggtgctggaggag
ctgggcctctccaatgccaccgatggtgactgcgccaacgtccgctacatctgcgagtgc
gtctcgaagcgagcggcccacctcgtctccgcgggcatcgccacgctgatcaacaaaatg
gacgagccccacgtgacggtcggcgtcgatggcagcgtctaccgtttccatcctaagttc
cacaatctgatggtggagaagatatcgcagctgatcaagccgggcatcaccttcgatctg
atgctctccgaggatggatctggacgcggtgcggcgctggtggcggcggttgcctgtcga
gaggacatactcaatagcaagtaa

DBGET integrated database retrieval system