KEGG   Drosophila mojavensis: Dmoj_GI15577
Entry
Dmoj_GI15577      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16679  wengen
Organism
dmo  Drosophila mojavensis
Pathway
dmo04013  MAPK signaling pathway - fly
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
dmo04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI15577
   04391 Hippo signaling pathway - fly
    Dmoj_GI15577
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI15577
   04215 Apoptosis - multiple species
    Dmoj_GI15577
SSDB
Motif
Pfam: TNFR_c6 PhoR stn_TNFRSF12A Comm
Other DBs
NCBI-GeneID: 6584167
NCBI-ProteinID: XP_002009825
FlyBase: FBgn0138326
UniProt: B4L3L4
LinkDB
Position
Unknown
AA seq 277 aa
MLAKIGSSIKSSYNSQQIETESNVSSGSIGGFVPPSSPCAPQHWWDQVQDKCMPCTSCQG
EMIPLRPCQLHIDTVCRSIYELKIDWVVLAKTEPNWKERRKSSEYEHFDQPTPLQHLTHE
QLQQLHEEAAAALPLDWQTGALFIAVLACLLFFSVAACILIHHMRQWRRMERRLDQDVEE
LSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAMTAASAAASAAQSSLFQPQHVLLPV
EKHTKHQERRILTLQPGNVYIEENQGLGAGVLANSKG
NT seq 834 nt   +upstreamnt  +downstreamnt
atgctggccaagatcgggagcagcatcaagagcagctacaattcacagcagatagagact
gaaagcaatgtcagcagcggcagcattggcggctttgtgccgcccagttcgccctgcgcg
ccgcagcattggtgggatcaggtgcaggacaagtgcatgccctgcaccagctgccagggc
gagatgataccgctgcgtccctgccagctgcacatcgacaccgtttgccgctccatctac
gagctgaagatcgactgggtggtgctggccaagacggagcccaactggaaggagcgccga
aagtcatcggagtacgagcatttcgatcagccaacgccgctgcagcacttgacccacgag
cagctgcagcagctgcacgaggaggcagccgctgccctgcccctcgactggcagacgggc
gccctcttcatagcggtgctcgcctgcctgctcttcttctcggtcgccgcctgcatactc
atccatcacatgcgccaatggcgccgcatggagcgccgactggaccaagatgtggaagag
ttgtccacgaagctaatggccaagctggccgaggtgcagagcctggacggtggcaccttc
ttcataggcaatgcggacgccctgcgcggactgcccgcctcggcaatgacggccgcctcg
gcggcagcgtccgctgcgcagtcgagcctctttcagccgcaacatgtgctgctgcctgtg
gagaaacataccaagcatcaggagcgaaggattctgacgctgcagccgggcaatgtgtat
atcgaggagaatcaaggactcggcgctggcgtcttggccaactcgaagggctga

DBGET integrated database retrieval system