KEGG   Drosophila mojavensis: Dmoj_GI16555Help
Entry
Dmoj_GI16555      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00330  Arginine and proline metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dmoj_GI16555
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     Dmoj_GI16555
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Dmoj_GI16555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN DUF4703 Gluconate_2-dh3
Motif
Other DBs
NCBI-GeneID: 6586605
NCBI-ProteinID: XP_002012216
FlyBase: FBgn0139303
UniProt: B4L9H2
LinkDB All DBs
Position
Unknown
AA seq 584 aa AA seqDB search
MFALWYLTFAVDEIRKRLAWLFSSNKPAAQKALDNKPATPAPAAAPAPAPAPTVKPSPAA
APAKPSSPAPSPKPVAATVAEPPKPVTPPKPAVVQPAPTPAPAPVVAPTVVPKPTPAAPS
SPAAPNTPTAPSTPPKAADSAKMPIPLPKSLTEANTNGNDNSTNGNAALNDVSLDKKLFD
AKLPASKVPKVDQEQLKDASKDFIHGEANAFVQSIKEAQQAGYRKQDTMVDAAVLAKLEE
GYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDA
EAYTVFADLFDPIIEDYHGGFKKTDKHPASDFGDVNSFGNVDPTNEYVISTRVRCGRSMQ
GYPFNPCLTEAQYKEMEEKVSSTLSSLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGD
RFLQAANACRFWPTGRGIYHNDNKRFLVWCNEEDHLRIISMQQGGDLGEIYRRLVTAVNE
IEKRIPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTR
GEHTEAEGGVYDISNKRRMGLTEYQAVKEMYDGITELIKLEKSL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcattgtggtatctgacgttcgccgttgacgaaatacgcaaacgtttggcctgg
ctttttagttccaataagccagccgcccagaaagcgttagacaataagcctgcaacacct
gcacctgcagcagcaccagcacccgctccagcaccgactgttaagcctagtccagctgca
gctcctgcaaagcccagttcacctgcgccatcacctaaaccagtagcagcgactgttgcg
gaaccaccaaagccagttactcctccgaaaccagcagttgtccagccagcgcctacacca
gctccagccccagttgtagctcctacagttgtacctaaaccaacaccagcagcgcccagt
tcacctgccgctccaaacacacccactgcacccagcactccacctaaggccgcagattct
gccaagatgccgattcccttgccgaaatccttgaccgaggccaataccaatggcaatgac
aactcaacgaatggcaatgccgccctaaatgatgtcagtctggacaagaagctcttcgat
gcaaagctgccggccagcaaagttccgaaagtggaccaagaacagcttaaggatgccagc
aaggatttcattcatggcgaggcaaacgcctttgtgcagtccatcaaggaggcacagcaa
gcgggttatcgcaaacaagacaccatggttgacgctgctgttctcgctaaactggaggag
ggttatgccaagttggctgcctctgactcgaagtcgctgttgaagaaatacctgaccaag
gaggtcttcgacaacctgaagaacaaggtgacaccgaccttcaagtcgactcttctggat
gtgatccagtccggtttggagaaccacgactctggcgttggcatctatgcccccgatgct
gaggcctacacagtgttcgccgatctgttcgatcccatcattgaggactaccatggtggc
ttcaagaagaccgataagcatcccgcatcggacttcggtgatgtgaacagcttcggcaat
gtcgatcccaccaacgagtatgtgatctcgactcgtgtccgttgcggtcgctcgatgcag
ggctatcccttcaacccttgcttgaccgaggcccagtacaaggagatggaagagaaggtc
agcagcactctgtccagcttggagggtgagctgaagggcaagttctatccattgactggc
atggagaaggccgtccagcagcagctgatcgacgatcacttcctgttcaaggagggcgat
cgcttcctccaggctgccaatgcctgccgcttctggcccacgggtcgtggcatctaccac
aacgacaacaagcgattcctggtctggtgcaatgaggaggatcatttgcgcatcatctcc
atgcagcagggtggcgatctgggcgagatctaccgtcgcctggtgaccgccgtcaatgag
atcgagaagcgcatcccattcagccacgatgaccgtcttggcttcttgaccttctgcccc
accaacttgggcaccaccatccgtgcctccgtgcacatcaaggtgcccaagctggcctcc
aacaaggccaagctcgaggaagtcgctgccaaatacaatctccaggtgcgcggcactcgc
ggtgagcacaccgaagccgagggcggtgtctatgacatctccaacaagcgtcgcatgggt
ctcaccgaataccaggccgtcaaggagatgtacgatggcatcaccgagttgatcaagctc
gagaagagcttgtaa

DBGET integrated database retrieval system