KEGG   Drosophila mojavensis: Dmoj_GI17775Help
Entry
Dmoj_GI17775      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmoj_GI17775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dmo01002]
    Dmoj_GI17775
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmo04147]
    Dmoj_GI17775
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dmoj_GI17775
Peptidases [BR:dmo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dmoj_GI17775
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI17775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Peptidase_S46
Motif
Other DBs
NCBI-GeneID: 6577213
NCBI-ProteinID: XP_002003182
FlyBase: FBgn0140516
UniProt: B4KK93
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MSTKLVIVILLQAAVAVLAGVCLIPEPVKRQRSLVNELFRRQPRLDGRIVGGHRINITDA
PHQISLQTSDHICGGSLISKEWIITAAHCTFGKQANQLRVRLGTSECSRNGQLLNIKKIV
QHEKFNYSNINNDFSLLQLQEPIEFDETKQAVKLPTQDQEFKDGDACYVSGWGSTQNPLE
SRDWLRQVKVPLVNQEDCNKKYSRYGGVTDSMICAGYMQGGKDACQGDSGGPMVNGDGVL
VGVVSWGFGCAMPNFPGVYSRVTHVREWIKEHSGV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaaattagtgattgttattctgcttcaagccgccgttgctgtcctggcgggc
gtctgtttgatacctgagcccgtcaagcgccaacgatcgctggtaaatgagctcttcagg
cgacagccacgcctcgatggtcgcattgttggtggccatcgtataaacataacagatgca
ccacatcaaatctcgttgcaaacatccgaccacatttgtggcggctcactaatctcgaaa
gagtggataataacggcagctcattgcacctttggcaagcaagccaatcagctacgcgtg
cggctgggcacttctgaatgctcccgaaatggacaactgctaaacatcaaaaagattgtt
caacatgaaaagttcaactactcgaatatcaacaatgatttttcgctgttgcagctgcag
gaaccaatagaattcgatgagaccaagcaggctgttaagctgccgacacaggatcaagag
tttaaggacggtgatgcgtgctatgttagcggctggggcagcacacagaatcctttggag
tcccgcgactggctgcgccaggtaaaggtgccgctggtcaaccaggaggattgcaataag
aaatacagtcggtacggcggtgtgacagatagcatgatctgtgctggatatatgcaaggt
ggcaaggatgcctgtcagggagattctggtggtcccatggtaaatggggacggcgtgttg
gtgggcgtggtgtcctggggctttggctgtgcaatgcccaactttccgggcgtatactcc
agagtaactcatgttcgtgaatggatcaaggagcacagcggtgtttag

DBGET integrated database retrieval system