KEGG   Drosophila mojavensis: Dmoj_GI18459Help
Entry
Dmoj_GI18459      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00020  Citrate cycle (TCA cycle)
dmo00190  Oxidative phosphorylation
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
Module
dmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dmo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmoj_GI18459
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmoj_GI18459
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dmoj_GI18459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 6580872
NCBI-ProteinID: XP_002006670
FlyBase: FBgn0141198
UniProt: B4KT93
LinkDB All DBs
Position
Unknown
AA seq 666 aa AA seqDB search
MSGIMRAPSILAKTAFASMQRVATVAAAATQQRRSYHVTPGYQKAKSANPDAISKQYPIV
DHEYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDD
WKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSL
KFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFENDECRGVLALN
LEDGSLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTALVARQGLPSEDLEFVQFHPT
GIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSRSITIEVMEGRGVG
PEKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNYR
GQVLTIDENGKDKIVRGLYAAGEAACSSVHGANRLGANSLLDLVVFGRACAKTIAEENKP
GEKAPELKDNAGEFSVANLDKLRHANGSITTADLRLKMQRCMQNHAAVFRDGPILQKGVS
EMKEIYKQFKDIKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEARKESRGAHAREDF
KDRIDEYDYSKPLESQQKKPIDQHWRKHTLAWVCSDDGDVELKYRPVIDQTLDNEVETVP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaataatgcgtgcgccatcgattttggccaaaactgcattcgcctcaatgcaa
cgtgtggcaacagtagctgccgcagcgacgcagcagcgccgcagctaccatgtaaccccc
ggataccagaaggctaaatcagcaaatcccgatgccatctccaagcaatatccgattgta
gatcacgaatacgatgcgattgttgtcggtgccggcggctcgggactgcgtgctgccttt
ggcctggtcgctgagggcttccgcacagcggttatcactaaactgtttcccacacgctcg
catacgattgctgcacagggaggcattaatgcggctcttggcaatatggaggaggatgac
tggaagtggcacatgtacgatacggtgaagggcagtgactggctgggcgaccaggatgcc
attcattatatgacacgcgaggcacccaaggctgtcattgagctggagaactacggcatg
cccttctctcgcacccaggatggcaagatctatcaacgtgccttcggcggccagagtctg
aagttcggcaagggcggtcaggcccacagatgttgcgccgtcgcggatcgtaccggccac
tcgctgctgcacaccctgtatggtcagtcgttgagctacgattgcaactactttgtggag
tactttgctctggatctgattttcgagaatgacgagtgccgtggcgtgctggcccttaat
ttggaggatggtagtctgcatcgcttccgtgcgaagaatacggtcatcgccacaggtggc
tatggacgcgccttcttctcctgcacctcggcacatacatgcactggcgatggcaccgca
ttggtggcccgtcagggtctgccctcagaggatctggagtttgtgcagttccatccgact
ggaatctatggcgccggctgtcttattactgagggctgccgcggtgagggtggctatctg
atcaattccaagggtgaacgtttcatggagcgctatgcgcctgtcgccaaggatttagct
tctcgcgatgttgtctcccgctccattactattgaggttatggagggccgcggtgtggga
cccgaaaaagatcacgtattcctgcagctgcatcatttgccgcccaaacagctggctgaa
cgtctgcccggcatttcagagactgctatgattttcgccggcgtcgatgtcacccgcgag
cccatccccgtgctgcccaccgtgcactacaacatgggtggcatcccaacgaattatcgt
ggccaggtgctgaccattgacgagaacggcaaggacaagattgtgcgcggcctctatgcg
gccggcgaggcagcctgcagctcggtgcatggcgccaatcgattgggtgccaactccctg
ctggatttggtggtgtttggccgtgcctgcgctaagaccattgccgaggaaaacaaaccc
ggcgagaaagcacccgagctgaaggacaatgctggcgagttctctgtggccaatttggat
aagctgcgtcatgcaaatggcagtataaccaccgcagatctgcgtctcaagatgcagcgc
tgcatgcagaaccatgctgctgtattccgtgatgggcccatcttgcagaagggcgttagc
gaaatgaaggagatctacaaacagttcaaggacatcaaagttattgacaagtcgcttgtg
tggaactcggatctaattgagacactggagctgcagaatcttctggccaatgctcagatg
accatcgtcggagctgaagcgcgcaaggaatcacgcggcgcacacgcacgcgaagatttc
aaggatcgcatcgatgaatacgactatagcaagcccttggaatcgcagcagaagaagccc
atcgaccagcattggcgtaagcacacgctcgcctgggtgtgtagcgatgatggcgatgtg
gaactcaaatacagaccagttattgaccagactctggacaatgaggtagagacggtgcca
ccagcaattcgctcttactag

DBGET integrated database retrieval system