KEGG   Drosophila mojavensis: Dmoj_GI18624
Entry
Dmoj_GI18624      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20017  Bcl-2 family protein
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI18624
   04215 Apoptosis - multiple species
    Dmoj_GI18624
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6580494
NCBI-ProteinID: XP_002006332
FlyBase: FBgn0141363
UniProt: B4KQC7
LinkDB
Position
Unknown
AA seq 298 aa
MPGTSFPTNNDNFSNGFPMVTTQAERLLQAQNRRKFSFPATLHSAALLEVGQRESTRRRL
SNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRS
ILGNSNTTMGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTSNSLNPLEWTTLVIGVVFGLILLVMFLRFIVNTLIPKIYQRFTS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccaggcacctcattcccaacgaacaacgacaacttcagcaacggcttccccatggtc
acgacccaagccgagcgactgctgcaggcgcagaatcgccgcaagttcagcttccccgcc
acactccactccgccgccctgcttgaggtgggccagcgggagtcaacgcgccgccggctc
agcaacgtcagcgatgtggttacccgcaaactgtcctacaccatcggctggaaggccgct
caaatacctgcccaagacattatcacacagggacgctgtttatgtggacactacatcaag
cggcggctgcgtcgctcgggactgttcaacaagaaactgggactgcagcgcattcgcagc
atattgggcaacagcaacacaactatgggcatcgtgagagacgttttcccagcggtgcaa
gtgttgggcgatgagctggagcgcatgcatccgcgcatctataatggtgtcgcccgacag
atttgccgcaatccgggcggcgagttccataccccggatgctgtgagtctgctgctgggc
gccgtgggccgggagctgtttcgggtcgagatcacatggagcaaggttatctcattgttt
gctatagccggtggtctgtccgtggactgtgtgcgccagggccatcccgagtatttgcca
aagcttatggagagcgtttccgaagtaatcgaggatgaactggtgccttggataaacgag
aacggcggttggagtggcatcaatacacacgttctaccaacatccaatagcttaaatcct
ctggaatggaccacgctggtgatcggagttgtatttggtttgattttattagttatgttt
ttgcgctttattgtcaacacacttatacctaaaatataccaacgatttacgagctga

DBGET integrated database retrieval system