KEGG   Drosophila mojavensis: Dmoj_GI18695Help
Entry
Dmoj_GI18695      CDS       T01062                                 

Gene name
Dmoj_Mal-A2
Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00052  Galactose metabolism
dmo00500  Starch and sucrose metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dmoj_GI18695 (Dmoj_Mal-A2)
   00500 Starch and sucrose metabolism
    Dmoj_GI18695 (Dmoj_Mal-A2)
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dmoj_GI18695 (Dmoj_Mal-A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 6580342
NCBI-ProteinID: XP_002006189
FlyBase: FBgn0141434
UniProt: B4KP58
LinkDB All DBs
Position
Unknown
AA seq 566 aa AA seqDB search
MSARLLLGLLAALVVGGAAASTDIDWWENAALYQIYPRSFQDSDGDGVGDLKGITQRLSY
LKEIGITATWLSPIFKSPMSDFGYDISDFKEIDEIFGTMADFDAMMVEAKALGLKIILDF
VPNHSSDECEWFQKSVNREDGYDDFYVWHDGKLNAETGEREPPSNWVSVFGGSQWTWHET
RQQYFLHQFQVKQPDLNFSNPMVREHMLDVLGFWLDRGVDGFRIDAVPHIYEHRNADGSY
RDEPLSGWNSDPNSYDYLDHIYTKDQPETVELMYEWRDYLLKYQQEHGGPTRVLLAEAYS
PVETLAAYFGNGTRLGTQLPMNFQLMYLSGYSTAREVVGSIDYWMETMWTQHQTANWVVG
NHDTQRVANRMGAHKVDLLNVIVNALPGASVTYYGEEIGMSNVETECTEISCDDRDGERT
PMQWAPVSNAGFSTGPSTWLPVSPDFERYNVQTERGVARSSLQVFKGLQQLKQSSAFLSF
KKKNGFSYEAITEQVLQIVRTNNLNEEYRILVNMGNGIEIIDGLADKVFEYILVTAYSLH
RPGEMIDLSRRLLLMPYEAIVLRWLA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgcgattacttcttggattgctcgcagcgctagtcgtgggtggcgcagccgcc
tcgacggacatcgattggtgggagaatgcggcgctgtatcagatctatccgcgatccttt
caggacagcgatggcgatggcgtgggggatttgaagggcataacccagcgcttgagctat
ctgaaggaaatcggcattacggccacttggctgtcgccgatattcaagtcgcccatgtcc
gatttcggttacgatatatcggacttcaaggagatcgacgaaatcttcggcacgatggcc
gactttgatgcgatgatggtggaggccaaggcactgggcctgaagatcatcttggacttt
gtgccgaaccattcaagcgatgaatgcgaatggtttcagaagtccgtcaatcgcgaggat
ggctacgatgatttctatgtgtggcacgatggcaagctgaacgccgagacaggggaacgc
gagccgcccagcaactgggtcagtgtctttggtggctcacagtggacctggcatgagacg
cgccagcagtacttcctgcatcagtttcaggtgaagcagcccgacctgaacttcagcaat
cccatggtgcgagagcacatgctggacgtgctgggcttctggctggatcgcggcgtggac
ggctttcgcatcgatgccgtgccgcacatctacgagcaccgcaacgccgatggcagctat
cgggacgagccactgagtggctggaacagtgatccgaatagctacgactacttggatcac
atctacaccaaggatcagccggagactgtggagctaatgtacgagtggcgcgactatctg
ctcaagtatcagcaggagcacggcggacccacccgagtgctgctcgccgaggcatacagc
ccggtggaaacgctagccgcctactttggcaatggcacgcggctgggcacacagctgcca
atgaacttccagctgatgtatctgagcggctactcgacggccagggaagtggtgggctcc
attgactactggatggagacgatgtggacgcagcaccagactgccaactgggtggtgggc
aaccacgacacacagcgcgtggcgaatcgcatgggcgcccacaaagtggatttgctgaat
gtgattgtgaacgcgctgcccggcgcctcggtcacctactatggcgaggagattggcatg
tcgaacgtggagacagagtgcacggaaatctcctgcgatgaccgcgatggcgaacgcaca
cccatgcaatgggctccggttagcaatgccggcttctccacaggccccagcacctggctg
ccagtcagtccggactttgagcgctacaatgtgcaaaccgaacggggcgtggcgcgttcc
tcgctgcaagttttcaagggactgcagcagctaaagcagagctctgcctttctatcattc
aagaagaagaatggcttttcctacgaggccatcacggagcaagtgctgcagattgtgcgc
accaacaatcttaatgaggaatatcgcatccttgtcaacatgggcaatggcatagagatt
atcgatggcctcgcagacaaggtctttgagtatatactggttactgcctactcgctgcat
agacctggagagatgattgatctgagcagaagactgctgcttatgccctatgaagcaatc
gtattacgttggctggcctga

DBGET integrated database retrieval system