KEGG   Drosophila mojavensis: Dmoj_GI19303Help
Entry
Dmoj_GI19303      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00020  Citrate cycle (TCA cycle)
dmo00190  Oxidative phosphorylation
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
Module
dmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dmo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmoj_GI19303
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmoj_GI19303
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dmoj_GI19303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer2 DNA_pol3_tau_4
Motif
Other DBs
NCBI-GeneID: 6579094
NCBI-ProteinID: XP_002004991
FlyBase: FBgn0142042
UniProt: B4KNG7
LinkDB All DBs
Position
Unknown
AA seq 296 aa AA seqDB search
MLVNEARQVLSRASSLAARHQLRAISNTTQLEQQAQPKAAQEPQIKKFEIYRWNPDNAGE
KPYMQTYEINMRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACI
SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGKAQYLQ
SVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSVERLS
KLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttggtcaacgaagccagacaggtcttgagccgcgccagctctttggcagcacgtcat
cagttgcgcgcaatcagcaacacgacgcagctggagcaacaggcacagcccaaggctgca
caagagccacagatcaagaagttcgagatctatcgctggaatccagacaatgccggcgag
aagccctacatgcagacctatgagatcaacatgcgtgagtgcggtcccatggtgctagat
gccttgatcaagatcaagaacgagatggatccgacactgacgttccgtcgttcgtgccgc
gagggcatttgcggatcgtgcgccatgaacattggcggcaccaacacgcttgcttgcatc
agcaagatcgatgcgaccagctcgaagcccctgaaggtgtacccgctgccccacatgtat
gtggtgagggatctggtgccggacatgaataacttctacgagcagtacaaaaatattcag
ccctggttgcagcgcaaaaacgaagccggggagaagaagggcaaggcacagtacttacaa
tcagtggaggatcgctccaagttggacggcctgtacgagtgcattctgtgcgcatgctgc
tccacctcatgcccgtcgtactggtggaatgccgagaagtaccttggcccggctgtgctg
atgcaggcatatcgctggatcattgactcgcgtgacgagaactccgttgagcgtctgagc
aagctgaaggatcccttcagcgtgtaccgttgccacaccatcatgaactgcacgcgcacc
tgtccgaagggcttgaatccgggtcgcgccattgccgagatcaagaaattgctctcgggc
ttggcctcgaagccggcgcccaaattggagactgcggcgcttcacaagtag

DBGET integrated database retrieval system