KEGG   Drosophila mojavensis: Dmoj_GI20496
Entry
Dmoj_GI20496      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI20496
   04215 Apoptosis - multiple species
    Dmoj_GI20496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmo01002]
    Dmoj_GI20496
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dmoj_GI20496
Peptidases and inhibitors [BR:dmo01002]
 Cysteine peptidases
  Family C14: caspase family
   Dmoj_GI20496
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 6579613
NCBI-ProteinID: XP_002005495
FlyBase: FBgn0143232
UniProt: B4KRY9
LinkDB
Position
Unknown
AA seq 318 aa
MTDEWKIRSFGSHDLDSGKINNNADTIDAKGEASTNSVRSGGAANAVAAPINKYVARMTT
DRYAKEYNMNHKHRGQALIFNHENFTIPYLSTRRGTNVDSEQLTKALERLGFEVSVHKDC
ILSEILQVVSKAAAKDHTDNDCIVIAVMSHGEHGHLYAKDVQYRLDSIWTYFTANNCPTL
AGKPKLFFIQACQGDKLDPGTTMVKETETDGDSSTSYKIPTHADFLFSYSTIPGYFSWRN
TDNGSWYIQSLIKELNENGKEYNMLTLLTFVSQRVAVDYESNVPSNPLMDRQKQIPCVTS
MLTRILRFNDKPPYSQAG
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggacgaatggaaaattagatcctttggctctcacgaccttgacagcggcaaaata
aacaacaatgctgataccatcgacgcaaaaggagaagccagcacaaattctgtgcgaagc
ggtggtgcagccaatgccgtcgcagccccaataaataaatatgtcgctcgtatgaccacc
gaccgatacgccaaggaatataatatgaatcataagcaccggggacaggccctcatcttc
aatcacgaaaatttcactataccctatctgtcaacgcgtcgcggcaccaatgtcgacagc
gaacagctaaccaaggccttggaacgtctaggtttcgaggtgagtgtccacaaggattgc
atcctgagcgagattctccaagttgtgagcaaggccgctgcaaaggatcacactgacaat
gattgcatagtgattgcggtgatgtcccatggcgagcacggtcacctctatgccaaagat
gtgcagtacaggctggacagcatctggacctattttaccgccaacaattgccccacgtta
gctggaaaaccgaagttattcttcatacaggcctgtcagggggataaactggatccaggc
acgacgatggtgaaggaaactgaaacggatggcgattcctcgacgagctacaaaatacct
acacatgccgactttctattctcatattcaacaataccaggatacttttcgtggcgcaat
actgataacggctcatggtacatacaatcgctcataaaggagctcaatgaaaatggcaag
gagtacaatatgctcacattgctgacttttgttagccaacgtgtggccgtggattacgaa
tcgaacgtgccatcgaatccgttgatggatcgtcagaagcaaattccatgtgtgacgtca
atgttgacgcgcattttgcgctttaatgacaaacccccttacagccaggccggctaa

DBGET integrated database retrieval system