KEGG   Drosophila mojavensis: Dmoj_GI20539Help
Entry
Dmoj_GI20539      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform E
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00030  Pentose phosphate pathway
dmo00051  Fructose and mannose metabolism
dmo00052  Galactose metabolism
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
dmo01230  Biosynthesis of amino acids
dmo03018  RNA degradation
Module
dmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI20539
   00030 Pentose phosphate pathway
    Dmoj_GI20539
   00051 Fructose and mannose metabolism
    Dmoj_GI20539
   00052 Galactose metabolism
    Dmoj_GI20539
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Dmoj_GI20539
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dmoj_GI20539
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmoj_GI20539
Messenger RNA biogenesis [BR:dmo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dmoj_GI20539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 6579687
NCBI-ProteinID: XP_002005569
FlyBase: FBgn0143275
UniProt: B4KSJ9
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MNSDTNQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEASWSSVSSIIHRGGTIIGSARCKDFRERAGRLKAANNLVQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELEKNKSITPEQKNKYNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAIASTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPAPTN
WQDDLCKKLAQERSAGQRLNIVIVAEGASDREGNPITAEQVRKVIDERLKHDARITVLGH
VQRGGNPSAFDRVLACRMGAEATLALMEATPESVPVVISLDGNQTVRVPLMECVERTQAV
AKAMAERRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDEQGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPATISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYSGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPSPFDRNMGTKMAAKCVDWLATQIKNNIDSNGVVNCKSTDTATL
LGIVSRQYRFTPLVDLIADTNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgatactaatcaacgtttcctggcacgcggctcccagcgcgacaagggcctg
gccgtcttcaccagcggtggcgactcccagggcatgaatgctgctgtgagggcatgtgtg
cgtatggccatctacttgggatgcaaggtctacttcattcgtgaaggctatcagggcatg
gttgatggcggcgattgcattcaggaagcatcttggtcgtcggtgtcatcgatcatacat
cgtggcggcaccatcattggctccgctcgttgcaaggacttccgtgagcgtgctggccgc
ctaaaggctgccaataacttggtgcaacgcggcattaccaatctggtggtaattggcggc
gatggctcgctgactggcgccaacctgttccgtcaggaatggtccagtctgctggatgag
ctggagaagaataagagcattacccctgagcagaagaacaagtacaatgttctgcatatt
gttggattggtgggttcgattgataacgatttctgtggcacggacatgaccattggcacg
gatacggccttgcaccgcatcattgaggccatcgatgccattgctagcactgcctactcg
catcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatttggcaatttca
gccgccattgccacagaggctgattttatgttcatacccgaagagcccgcaccaactaac
tggcaggatgatctgtgcaaaaagttagctcaggagcgttcagctggtcagcgtctgaac
atcgtcattgtggccgagggagccagtgatcgggagggcaatccaattaccgccgagcag
gtgcgcaaggtgatcgacgagcgtctcaaacacgacgctcgtatcactgtcttgggtcac
gtgcaacgcggtggcaatcccagcgccttcgatcgtgtcttggcttgccgcatgggcgcc
gaggccacattggctctgatggaagccacgccggagtcagtgccggtggtcatctcgctg
gacggcaaccagacggttcgtgtgcctcttatggagtgtgtggagcgcacccaggctgta
gctaaggccatggcggagcgtcgctgggccgatgctgtgaagctgcgcggtcgttccttt
gaacgcaacctggagacctacaagatgttgacgcgcttgaagccgcccaaggagaacttc
gacgagcagggcaagggcatcgagggctacaggctggctgtgatgcacattggtgcgccg
gcctgcggcatgaatgcggccgtgcgcagctttgtgcgcaatgccatctatcgcggcgat
gttgtctatggcatcaacgatggcgttgagggcctcattgctggcaatgtgcgcgagctg
ggctggtctgatgtctctggctgggtgggtcagggtggtgcttacctgggcaccaagcgt
actctgcccgagggcaagttcaaggagatcgccgctcgcctcaaggagttcaagatccaa
ggtctgctgatcatcggtggttttgagagctaccacgccgctggccaaatctccgatcag
cgcgacaactatccagagttttgcatacccattgtggttgtgccagcaaccatttcgaac
aatgtgcccggcaccgaattctcgctcggctgcgataccggcttgaatgagatcaccgaa
atctgcgatcgcattcgccagtcggcccagggcaccaagcgtcgtgtgtttgtcattgag
accatgggtggctatagcggctatttggccacgttggctggcctggctggtggtgcggat
gccgcgtatatatatgaggagaagttctccatcaaggatctgcaacaggatgtctatcac
atggcatccaaaatggccgagggcgtgtctcgcggcctcatcttgcgcaatgagaaggcc
agtgagaactacaccactgacttcatctatcgcctgtactcagaggagggcaagggtctg
ttcacctgccgcatgaacatcttgggccacatgcaacagggtggctctcccagtccattc
gatcgcaacatgggcaccaaaatggccgccaagtgcgtcgattggctggccacacagatc
aagaacaacatcgacagcaatggcgtcgtcaactgcaaatcgaccgacacagcaacactg
ctgggcatcgtctcgcggcagtatcgattcacgcccctggtcgatctcattgccgacacc
aactttgatcaacgcataccgaagaagcagtggtggctgcgcctgcgtccattgctgaga
attctggctaagcacgactcggcctacgaggaggagggcatgtacatcaccgtcgaggag
gagtgcgccacagatgccgtcgcttag

DBGET integrated database retrieval system