KEGG   Drosophila mojavensis: Dmoj_GI20719Help
Entry
Dmoj_GI20719      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dmo  Drosophila mojavensis
Pathway
dmo03030  DNA replication
dmo03410  Base excision repair
dmo03420  Nucleotide excision repair
dmo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dmoj_GI20719
   03410 Base excision repair
    Dmoj_GI20719
   03420 Nucleotide excision repair
    Dmoj_GI20719
   03430 Mismatch repair
    Dmoj_GI20719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dmo03032]
    Dmoj_GI20719
   03400 DNA repair and recombination proteins [BR:dmo03400]
    Dmoj_GI20719
Enzymes [BR:dmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dmoj_GI20719
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dmoj_GI20719
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dmoj_GI20719
DNA replication proteins [BR:dmo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dmoj_GI20719
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dmoj_GI20719
DNA repair and recombination proteins [BR:dmo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dmoj_GI20719
   NER (nucleotide excision repair)
    Other NER factors
     Dmoj_GI20719
   MMR (mismatch exicision repair)
    Other MMR factors
     Dmoj_GI20719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Mob_synth_C
Motif
Other DBs
NCBI-GeneID: 6580009
NCBI-ProteinID: XP_002005882
FlyBase: FBgn0143454
UniProt: B4KMC9
LinkDB All DBs
Position
Unknown
AA seq 736 aa AA seqDB search
MQKSITSFFKPKDESQNSKYAEDARKKETKSASIEEKPKVPTPVKTIKEEGDENALPTVD
SEEKMELEAPSPVKVRKMELNSGLPENEASEAYDPSVETYHPINDAYWKAQRTTPYLALA
RTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLLPCVYLSINQLAPAYEGLELGVAETT
LMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFRPKPLNVRGVFAKLKEIAN
ISGQAKITLVYDVFVACRHAEARFFIRSLIGKLRIGIAEQSLLTALAIALVKRNHINDCK
AHKVCDIYKDEIADTTLILKTTYSQCPNYDIVIPALLKYDIKELQDRCPMHPGMPLRPML
AQPTKGVSEVLERFSGMQITCEWKYDGERAQIHLNKDGEISIFSRNSENNTPKYPDLIAR
SKSLVKGNVETYILDSEIVAWDIERKQILPFQILTTRKRKNVDIADIKVQVCVYIFDLLY
FNGVSLVTKPLSERRKILMEHFQEVEGEWQFATALDTTDMDEVQQFLEESIKGNCEGLMV
KTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGIYGGFLLACYD
TENEEYQSICKIGTGFTDEDLRQHSEFLSAHVISSAKSYFRYDPSLEPDAWFEPVQVWEV
KCADLSLSPIHRAAIGAVDPERGISLRFPRFIRIRDDKSPENATDANQVSLMYNSQDQVK
NNQKSSDQMDMESDFY
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtcgataacctcattttttaaaccaaaggatgaaagtcaaaactcaaaatac
gcggaggatgcacgtaagaaggaaactaaaagtgcaagcattgaggaaaagcctaaagta
ccaactcctgtgaaaaccataaaggaggaaggagatgaaaatgcgctgccgacggttgat
tctgaggaaaagatggagcttgaggcgccgtcgcctgttaaggtaaggaaaatggaattg
aactctgggttgcctgaaaacgaagcaagtgaagcctacgatccgtcggtggaaacctat
catcccattaatgatgcctattggaaagcgcagcgcaccacgccctacttggccttggcc
cgtacgtttcaagttattgaggagacaaaaggccgactgaaaatgattgatacattgagt
aatttcttttgctccgtaatgctggttagtccggaggacttactgccgtgcgtttacctg
agtatcaaccagctagcgcccgcgtacgagggactcgaactaggcgtcgccgaaacgacg
cttatgaaagcaatctgcaaggcaaccggacgcaatttggcgcacatcaaatcgcaaact
caattaactggtgatctgggcattgtcgctgagcagtcccgcgtatcgcagcgcatgatg
tttcgtccgaagccattaaatgtgcgcggcgtgttcgccaaactaaaggagattgccaac
atttcgggacaggcgaaaataaccctcgtctacgatgtgttcgtggcttgccgacatgcc
gaagcgcgcttctttatacgttccctaattggcaaattacgcattggcattgccgaacag
agcctgctcacggctctagcaatagctctcgtcaaacggaaccacatcaacgattgcaag
gcccataaagtttgtgatatttacaaagatgaaatagcggatacaacattgatacttaaa
accacatatagccaatgcccgaactacgatatcgtcataccagcattattgaaatatgat
attaaggaactgcaagatcgttgccctatgcatcccggtatgccgcttaggcctatgctc
gcccagccaacgaaaggtgtttcggaagtgctggaacgcttcagtggcatgcaaataact
tgtgaatggaaatacgacggtgaacgagcccaaatccatttgaataaagatggcgaaatt
agtattttctcacgaaattcggagaacaacacgccaaagtatccagatctgattgctaga
agcaaatcattagtgaaaggcaacgttgagacatatatacttgatagcgagattgtcgcc
tgggatatcgaacgcaagcaaattcttccatttcaaattctaacaacgcgcaagcgcaaa
aatgtcgatatcgctgacattaaagtgcaagtgtgcgtatacattttcgatctactgtac
tttaatggagtttcgcttgtgacaaagccgctgtctgagcgtcgcaagattctgatggaa
cactttcaagaggtggaaggcgagtggcaatttgccacagccctcgacacgaccgacatg
gatgaagtgcagcaattcctagaggaatccattaaaggcaactgcgagggtctcatggtc
aaaacattggacgaagaggcaacctatgaaatagcgaaacgatcaagaaattggctcaaa
ttgaagaaggactatttgtcaaatgttggcgactcactggacctggttgtgatcggtggt
tataagggcaaaggccgacgcacgggcatctacggtggctttctgctcgcttgctatgat
acagagaatgaagaatatcaaagcatttgcaagatcggaacaggcttcacagatgaagat
ttgcgacaacattcggagttccttagtgcgcatgtgattagcagtgccaaatcatacttt
agatatgatccaagcttggagccggatgcttggtttgagcccgttcaagtttgggaagtt
aagtgtgctgatctgtccctaagtccgatccatagagccgccataggagctgttgatcct
gaacgcggcatttccttgcgttttccgcgattcattcgcattcgggacgataagagcccg
gaaaatgccaccgatgcgaatcaagtatctctcatgtacaactcacaggatcaggttaaa
aacaatcaaaagtccagcgatcaaatggacatggagagtgatttttattaa

DBGET integrated database retrieval system